Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate WP_057508392.1 ABB28_RS09475 dTDP-glucose 4,6-dehydratase
Query= BRENDA::P9WN67 (314 letters) >NCBI__GCF_001431535.1:WP_057508392.1 Length = 351 Score = 145 bits (367), Expect = 1e-39 Identities = 109/327 (33%), Positives = 155/327 (47%), Gaps = 26/327 (7%) Query: 4 LVTGAAGFIGSTLVDRLLADGHSVVGLDNFA-TGRATNLEHLADNSAHVFVEADIVTADL 62 LVTG AGFIG V A G V+ LD G L L NS HVFVE DI + L Sbjct: 5 LVTGGAGFIGGNFVLDAAARGVKVINLDALTYAGNLKTLSSLGGNSNHVFVEGDIGDSAL 64 Query: 63 HA-ILEQHRPEVVFHLAAQIDVRRSVADPQFDAAVNVIGTVRLAEAAR--------QTGV 113 + +L +H+P+ V + AA+ V RS+ P+ NV+GT+ L EA R + G Sbjct: 65 VSRLLAEHQPDAVLNFAAESHVDRSIDGPRAFIQTNVVGTLGLLEAVRDYWKALPAEKGT 124 Query: 114 R-KIVHTSSGGSIYGTPPEYPT-PETAPTDPASPYAAGKVAGEIYLNTFRHLYGLDCSHI 171 + +H S+ +YGT E ET P P SPY+A K A + + F H YGL Sbjct: 125 AFRFLHVSTD-EVYGTLGETGKFSETTPYAPNSPYSASKAASDHLVRAFHHTYGLPVLTT 183 Query: 172 APANVYGPRQDPHGEAGVVAIFAQALLSGKPTRVFGDGTNTRDYVFVDDVVDAFVRVSAD 231 +N YGP P E + + A+AL +G+P V+GDG RD++FV D +A V A Sbjct: 184 NCSNNYGPYHFP--EKLIPLVIAKAL-AGEPLPVYGDGKQVRDWLFVSDHCEAIRTVLAK 240 Query: 232 VGGGLRFNIGTGKETSDRQLHSAVAAAVGGPDDPEFHPPRLGDL----------KRSCLD 281 G +N+G E + ++ A+ A + E PR + +R +D Sbjct: 241 GRVGETYNVGGNSEKQNIEVVQAICALLDARRPREDGQPRSSQITYVTDRPGHDRRYAID 300 Query: 282 IGLAERVLGWRPQIELADGVRRTVEYF 308 + LGW P G+ TV+++ Sbjct: 301 ASKLKDELGWEPAYTFEQGIGFTVDWY 327 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 19 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 351 Length adjustment: 28 Effective length of query: 286 Effective length of database: 323 Effective search space: 92378 Effective search space used: 92378 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory