Align UTP--glucose-1-phosphate uridylyltransferase; EC 2.7.7.9; Alpha-D-glucosyl-1-phosphate uridylyltransferase; UDP-glucose pyrophosphorylase; UDPGP; Uridine diphosphoglucose pyrophosphorylase (uncharacterized)
to candidate WP_057508393.1 ABB28_RS09480 glucose-1-phosphate thymidylyltransferase
Query= curated2:P75124 (291 letters) >NCBI__GCF_001431535.1:WP_057508393.1 Length = 297 Score = 78.2 bits (191), Expect = 2e-19 Identities = 84/277 (30%), Positives = 123/277 (44%), Gaps = 56/277 (20%) Query: 5 RKAVIPAAGLGTRLLPATKAIPKEMLPLVNKPTIQYIVEEAVASGIKEILVIVSSKKEAI 64 RK +I A G GTRL P TK I K++LP+ +KP I Y + + +GI+E+L+I + Sbjct: 6 RKGIILAGGSGTRLYPITKGIGKQLLPVYDKPMIYYPLSVLMLAGIREVLIINAPH---- 61 Query: 65 IDHFDYDFILENALLQKHKDQEHQEIKDIANLAHIYFVRQKHQHGLGDAILHAKSFVGNE 124 E AL Q+ Q D I + Q GL A L + F+ + Sbjct: 62 ----------EQALFQQLLGDGSQWGMD------IQYAAQPSPDGLAQAYLIGREFLDGK 105 Query: 125 DFAVLLGDDVVFGEQPALAQCIQAYEQTDCQVIGVQEVPHDQVNKYG--IVTPE----AN 178 ++LGD+V G + TD V+ + HD +G + PE A Sbjct: 106 PSCLVLGDNVFHG-----------HGLTD--VLKRADARHDGATVFGYWVSDPERYGVAE 152 Query: 179 WQKQALVKILGMVEKPAVNEAKSNLAILSRYIL--KPSIFTA-LKQVPFGVGGELQLTDG 235 + K K++G+VEKPA + +SN A+ Y K S + A LK P GEL++TD Sbjct: 153 FDKDG--KVIGLVEKPA--KPRSNYAVTGLYFYDGKASEYAADLKPSP---RGELEITDL 205 Query: 236 LNYCLQQG----EPFFAKHFGGTRFDVGTKNGFIKAN 268 L +G EP G D GT ++A+ Sbjct: 206 NQRYLDEGALHLEPLGR---GYAWLDTGTHQSLLEAS 239 Lambda K H 0.320 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 297 Length adjustment: 26 Effective length of query: 265 Effective length of database: 271 Effective search space: 71815 Effective search space used: 71815 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory