Align Acetyl-CoA acetyltransferase; EC 2.3.1.9; Acetoacetyl-CoA thiolase (uncharacterized)
to candidate WP_057508480.1 ABB28_RS09885 3-oxoadipyl-CoA thiolase
Query= curated2:P44873 (393 letters) >NCBI__GCF_001431535.1:WP_057508480.1 Length = 402 Score = 333 bits (854), Expect = 5e-96 Identities = 191/409 (46%), Positives = 265/409 (64%), Gaps = 23/409 (5%) Query: 1 MENVVIVSAVRTPIGSFNGALSSVSAVDLGAIVIQEAIKR-ANIESALVNEVIMGNVLQA 59 M + I+ +RTPIG + GAL+ V A DLGAI +Q + R ++ AL+ EV +G QA Sbjct: 1 MHDTYIIDGIRTPIGRYAGALAGVRADDLGAIPLQALLARHPGLDPALIEEVYLGCTNQA 60 Query: 60 GL-GQNPARQAALKAGIEKEIPSLTINKVCGSGLKSVALGAQSIISGDADIVVVGGMENM 118 G +N AR + L AG+ +P T+N++CGSGL ++ A+ I +G+ + + GG+E+M Sbjct: 61 GEDNRNVARMSLLLAGLPVTVPGSTVNRLCGSGLDAIGTVARGIAAGELGLAIAGGVESM 120 Query: 119 SQAPYLLDSKVRQGVKMGNLTLRDTMIEDG------LTCASNHYH----MGITAENIAEQ 168 S+AP ++ K G RD ++ED + H MG TAEN+AE+ Sbjct: 121 SRAPMVMG-------KAGTPFARDQVLEDTTMGWRFINPRLRELHGVETMGQTAENVAER 173 Query: 169 YGISRQAQDELALRSQTLASQAVQLGVFDKEIVPVMVK-TRKGDII-VSRDEYPKADTTA 226 + ISR+ QD ALRSQ A+ A Q G FD EI+ V V R+G+ + V DE+P+ADTT Sbjct: 174 HAISREDQDRFALRSQQRAAAAQQAGFFDGEIIAVDVPGRRRGETVRVEHDEHPRADTTL 233 Query: 227 EGLAKLKPAFKKEGTVTAGNASGINDGAAALILVSESKAHALGLKAIAKIRSYASGGVDP 286 E LA+LKP F++ G+VTAGNASGINDGAAAL+L S ++ ALGL A+I +AS GV+P Sbjct: 234 EALARLKPLFRQPGSVTAGNASGINDGAAALLLASAAQVQALGLTPRARILGFASAGVEP 293 Query: 287 SVMGLGPVPATQKALKKAGINLDDIDLIEANEAFASQFLGVGKDLNL--DMNKTNIHGGA 344 SVMG+GPVPAT++ L + G+++ D D IE NEAFASQ L ++L L D N +GGA Sbjct: 294 SVMGMGPVPATRRLLARLGLSIADFDAIELNEAFASQGLACLRELGLADDAPHVNANGGA 353 Query: 345 IALGHPIGASGARILVTLLHNLIEKDKKLGLATLCIGGGQGISMIVERL 393 IALGHP+G SGARI +TL+ L + GLAT+CIG GQG+++ +ER+ Sbjct: 354 IALGHPLGMSGARIALTLMRQLEASGGRRGLATMCIGVGQGVALAIERV 402 Lambda K H 0.315 0.133 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 402 Length adjustment: 31 Effective length of query: 362 Effective length of database: 371 Effective search space: 134302 Effective search space used: 134302 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory