Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_057508494.1 ABB28_RS10050 aminotransferase
Query= BRENDA::Q8NTR2 (432 letters) >NCBI__GCF_001431535.1:WP_057508494.1 Length = 436 Score = 308 bits (788), Expect = 3e-88 Identities = 173/409 (42%), Positives = 242/409 (59%), Gaps = 9/409 (2%) Query: 25 EDIKRKFDELKSKNLKLDLTRGKPSSEQLDFADELLALPGKGDFKAADGTDVRNYGGLDG 84 ++++ D + + D+TRG PS EQ+ + +L+LPG F + DG D NYGG G Sbjct: 15 DELRAWHDACRKAPVAFDMTRGLPSDEQIALSHAMLSLPGPAPFDSGDGQDWLNYGGQQG 74 Query: 85 IVDIRQIWADLL-GVPVEQVLAGDASSLNIMFDVISWSYIFGNNDSVQPWSKEETVKWIC 143 I +R + A LL GVP Q G SSL +M + ++ G PWS V+++C Sbjct: 75 IPQLRALLAPLLLGVPATQAAVGGNSSLALMHAAVGLAWRIGLPGHA-PWSDAHEVRFLC 133 Query: 144 PVPGYDRHFSITERFGFEMISVPMNEDGPDMDAVEELV-KNPQVKGMWVVPVFSNPTGFT 202 PVPGYDRHF+I G ++ VPM DGPDM+ VE+ V ++P+++GMW VP SNP G T Sbjct: 134 PVPGYDRHFAICSDHGIALVPVPMGHDGPDMERVEKHVAQDPRIRGMWCVPRHSNPCGAT 193 Query: 203 VTEDVAKRLSAMETAAPDFRVVWDNAYAVHTLTDEFPEVIDIVGLGEA---AGNPNRFWA 259 + +V +RL+ M AAPDF + DNAYA+H D P+ + GL +A AGNP+R Sbjct: 194 YSAEVLRRLATMHAAAPDFTLFCDNAYAIH---DFAPQALARPGLYDACATAGNPDRVLL 250 Query: 260 FTSTSKITLAGAGVSFFLTSAENRKWYTGHAGIRGIGPNKVNQLAHARYFGDAEGVRAVM 319 F STSK+T+ GAGV+ SA W+ IGP+KVNQ+ H R+FG+A GV M Sbjct: 251 FGSTSKMTIPGAGVALLGGSARIMDWWLAAQRACTIGPDKVNQVRHLRFFGNAAGVARHM 310 Query: 320 RKHAASLAPKFNKVLEILDSRLAEYGVAQWTVPAGGYFISLDVVPGTASRVAELAKEAGI 379 ++H L +F +V + RL W+ PAGGYFI+L + G A RV LA +AG+ Sbjct: 311 QQHGHLLQQRFAQVQRVFAQRLRTPCDVHWSRPAGGYFITLWLPTGCARRVVSLASQAGV 370 Query: 380 ALTGAGSSYPLRQDPENKNLRLAPSLPPVEELEVAMDGVATCVLLAAAE 428 LT AG+++ DPE++ LR+APS PV + A + +A CVLLA A+ Sbjct: 371 RLTPAGTTHCGGTDPEDRCLRIAPSRLPVADAARAAEIIAGCVLLACAD 419 Lambda K H 0.318 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 556 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 436 Length adjustment: 32 Effective length of query: 400 Effective length of database: 404 Effective search space: 161600 Effective search space used: 161600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory