Align serine racemase (EC 5.1.1.18) (characterized)
to candidate WP_057508536.1 ABB28_RS10275 pyridoxal-phosphate dependent enzyme
Query= BRENDA::Q2PGG3 (331 letters) >NCBI__GCF_001431535.1:WP_057508536.1 Length = 320 Score = 266 bits (680), Expect = 5e-76 Identities = 140/310 (45%), Positives = 206/310 (66%), Gaps = 5/310 (1%) Query: 14 SIKEAHDRIKPYIHRTPVLTSESLNSISGRSLFFKCECLQKGGAFKFRGACNAVLSLDAE 73 ++ EA RI P+ TPVL S++L++++G L FK E LQ+ GAFKFRGACNAV SL A+ Sbjct: 11 AVLEAAARIAPHAAVTPVLRSQTLDALAGAQLAFKAEHLQRSGAFKFRGACNAVWSLSAD 70 Query: 74 QAAKGVVTHSSGNHAAALSLAAKIQGIPAYIVVPKGAPKCKVDNVIRYGGKVIWSEATMS 133 +A GVVTHSSGNH AAL+LAA+ +GI ++VVP GA K+ N+ R+G + T++ Sbjct: 71 RAPAGVVTHSSGNHGAALALAARTRGIACHVVVPDGAVAAKLANIARHGATLWRCAPTIA 130 Query: 134 SREEIASKVLQETGSVLIHPYNDGRIISGQGTIALELLEQIQEIDAIVVPISGGGLISGV 193 +RE + ++V +TG+ L+HPY D +I+GQGT LELL+ D +VVP+ GGGL +G Sbjct: 131 AREAVCAQVQADTGATLVHPYADAAVIAGQGTAVLELLQAEGPFDVVVVPVGGGGLAAGT 190 Query: 194 ALAAKSIKPSIRIIAAEPKGADDAAQSKVAGKIITLPVTNTIADGLRASLGDLTWPVVRD 253 ALA + + P R++ AEP GA D A+S AG+ V +T+ DGLR +LG + +++ Sbjct: 191 ALALQQVSPHTRLVLAEPAGAADTARSLQAGERRIDFVPDTVCDGLRGTLGAPNFQLLQA 250 Query: 254 LVDDVVTLEECEIIEAMKMCYEILKVSVEPSGAIGLAAVLSNSFRNNPSCRDCKNIGIVL 313 +V+ +++ + AM++ +++LK +VEPS AI LAAVL+ P +G+VL Sbjct: 251 AGAEVIVVDDAATVAAMRLLWQVLKQTVEPSSAIALAAVLA-----QPQRFAGLRVGLVL 305 Query: 314 SGGNVDLGSL 323 SGGNVD+ +L Sbjct: 306 SGGNVDIDAL 315 Lambda K H 0.316 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 320 Length adjustment: 28 Effective length of query: 303 Effective length of database: 292 Effective search space: 88476 Effective search space used: 88476 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory