Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_057508628.1 ABB28_RS10765 SDR family NAD(P)-dependent oxidoreductase
Query= BRENDA::Q1J2J0 (255 letters) >NCBI__GCF_001431535.1:WP_057508628.1 Length = 252 Score = 147 bits (371), Expect = 2e-40 Identities = 102/250 (40%), Positives = 137/250 (54%), Gaps = 15/250 (6%) Query: 14 FRLDGRHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVGEGAARELDGTFER----- 68 ++L G+ A+VTGG GIG +A LA +GA +++ DL + + L G + Sbjct: 4 YQLKGKTAIVTGGVSGIGLAVAEMLAASGAAISVWDLKQEAVDATTEALRGKGVKAIGIA 63 Query: 69 LNVTDADAV-ADLAR---RLPDVDVLVNNAGIVRNAPAE-DTPDDDWRAVLSVNLDGVFW 123 L+VTD AV A +AR L VD+ VNNAGI A D P D WR V+ VNL VF Sbjct: 64 LDVTDEAAVEAAVARTVAELGSVDIAVNNAGIAGPAAISGDYPVDGWRKVIDVNLTSVFL 123 Query: 124 CCREFGRTMLARGRG-AIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRG 182 C R + M G G +I++ AS+ G + AY A+K V+ LT++ A E AS Sbjct: 124 CQRAQIQAMRDAGNGGSIINMASILGQVGY--AGSVAYAAAKHGVVGLTQTAAWEHASDQ 181 Query: 183 VRVNAVAPGYTATPLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLYLASDAASFVT 242 +R+NAV PG+ +TPL + P+ R T L RL P E+A V +LASDAASF T Sbjct: 182 IRINAVGPGFISTPLLEQ--MDPKVRATLESRHALKRLGTPEEVAALVAWLASDAASFAT 239 Query: 243 GHTLVVDGGY 252 G +DGGY Sbjct: 240 GTYYAIDGGY 249 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 252 Length adjustment: 24 Effective length of query: 231 Effective length of database: 228 Effective search space: 52668 Effective search space used: 52668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory