Align lactoylglutathione lyase (EC 4.4.1.5) (characterized)
to candidate WP_057508877.1 ABB28_RS12120 lactoylglutathione lyase
Query= BRENDA::Q88GF8 (175 letters) >NCBI__GCF_001431535.1:WP_057508877.1 Length = 172 Score = 257 bits (656), Expect = 8e-74 Identities = 120/169 (71%), Positives = 138/169 (81%), Gaps = 1/169 (0%) Query: 1 MSLHDLQTLPGVTAQPDAATAQFVFNHTMLRVKDIEKSLDFYTRVLGFRLVDKRDFPEAA 60 MSL DLQT+PGV AQP A TA FVFNHTMLRVKD SLDFYTRVLG+RL+DKRDF EA Sbjct: 1 MSLSDLQTVPGVAAQPPAETAGFVFNHTMLRVKDATASLDFYTRVLGYRLIDKRDFAEAQ 60 Query: 61 FSLYFLALVDPAQI-PADDTARHQWMKSIPGVLELTHNHGTENDADFAYHNGNTDPRGFG 119 FSLYFLAL+ + P D R WM IPGVLELTHNHGTE YH+GN+DPRGFG Sbjct: 61 FSLYFLALLPAGTVVPESDAERRLWMAGIPGVLELTHNHGTEAQDGPVYHDGNSDPRGFG 120 Query: 120 HICISVPDVRAACARFEELEVPFQKRLQDGRMNHLAFVKDPDGYWVEVI 168 HIC+SVPD+++AC RF++L+VP+QKRL+DGRM HLAF+KDPDGYWVE+I Sbjct: 121 HICVSVPDIQSACKRFDDLQVPYQKRLEDGRMKHLAFIKDPDGYWVEII 169 Lambda K H 0.323 0.139 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 175 Length of database: 172 Length adjustment: 19 Effective length of query: 156 Effective length of database: 153 Effective search space: 23868 Effective search space used: 23868 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
Align candidate WP_057508877.1 ABB28_RS12120 (lactoylglutathione lyase)
to HMM TIGR00068 (gloA: lactoylglutathione lyase (EC 4.4.1.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00068.hmm # target sequence database: /tmp/gapView.1942.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00068 [M=150] Accession: TIGR00068 Description: glyox_I: lactoylglutathione lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-46 142.7 0.0 3.7e-46 142.4 0.0 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057508877.1 ABB28_RS12120 lactoylglutathione Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057508877.1 ABB28_RS12120 lactoylglutathione lyase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 142.4 0.0 3.7e-46 3.7e-46 11 141 .. 18 171 .. 9 172 .] 0.95 Alignments for each domain: == domain 1 score: 142.4 bits; conditional E-value: 3.7e-46 TIGR00068 11 eatkkylllhtmlrvgdldksldfytevlGmkllrkkdfpeekfslaflgyedessa............ 67 +t ++++ htmlrv+d +sldfyt+vlG +l+ k+df e +fsl+fl+ + + lcl|NCBI__GCF_001431535.1:WP_057508877.1 18 AETAGFVFNHTMLRVKDATASLDFYTRVLGYRLIDKRDFAEAQFSLYFLALLPAGTVvpesdaerrlwm 86 568899********************************************9998888899999****** PP TIGR00068 68 ....avieLtynwgtek.....ydlGn....gfGhiaiavddvykacervkakGgkvvrepgpvkggtk 123 v+eLt+n+gte y+ Gn gfGhi ++v+d+++ac+r+ ++ + + ++ +g++k lcl|NCBI__GCF_001431535.1:WP_057508877.1 87 agipGVLELTHNHGTEAqdgpvYHDGNsdprGFGHICVSVPDIQSACKRFDDLQVPYQKRL--EDGRMK 153 ****************99*****************************************99..****** PP TIGR00068 124 viafvkDPDGykiellek 141 ++af+kDPDGy++e++ + lcl|NCBI__GCF_001431535.1:WP_057508877.1 154 HLAFIKDPDGYWVEIISN 171 ***************975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (150 nodes) Target sequences: 1 (172 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 5.92 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory