Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate WP_057508907.1 ABB28_RS12160 methionine ABC transporter ATP-binding protein
Query= TCDB::Q97VF5 (362 letters) >NCBI__GCF_001431535.1:WP_057508907.1 Length = 335 Score = 121 bits (303), Expect = 3e-32 Identities = 82/237 (34%), Positives = 129/237 (54%), Gaps = 10/237 (4%) Query: 61 RIIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPPGKIISGKVIFNGMDIFS 120 R I A+ + +++GE+ GIIG SG+GK+TLI I R P G G+++ G D+ + Sbjct: 16 RAISALQPLDLTIQEGEVFGIIGHSGAGKSTLIRMINRLEDPSG----GRLLIAGEDVTA 71 Query: 121 MTIDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAISHGEADKKRVIERASELLKL 180 + R L + I + Q N L+ S + + + + ++ R +ELL+ Sbjct: 72 LETAGLRTLR-RRIGMIFQHF-NLLSSRTVASNVAF--PLELAGTPRAQIDARVAELLQT 127 Query: 181 VGLDPARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEPTSALDMLNQELLLKLIKN 240 VGL YP QLSGG KQRV IA +L P+++L DE TSALD +L L+ Sbjct: 128 VGLQAHA--DKYPAQLSGGQKQRVGIARALATGPQILLCDEATSALDPQTTASVLALLSK 185 Query: 241 INQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEEIIKSPLNPYTSLLVS 297 IN+E+G+TIV +TH++ I ++ +R+ V+ G ++E G ++ P +P T VS Sbjct: 186 INRELGLTIVLITHEMDVIRRVCDRVAVLDAGEMVEMGPVTDVFLHPQHPTTRRFVS 242 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 335 Length adjustment: 29 Effective length of query: 333 Effective length of database: 306 Effective search space: 101898 Effective search space used: 101898 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory