Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate WP_057508907.1 ABB28_RS12160 methionine ABC transporter ATP-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >NCBI__GCF_001431535.1:WP_057508907.1 Length = 335 Score = 129 bits (325), Expect = 9e-35 Identities = 78/240 (32%), Positives = 130/240 (54%), Gaps = 7/240 (2%) Query: 4 LELRNVNKTYGPG--LPDTLKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGGA 61 +E + ++K+Y L+ ++L I +GE ++G SG GKSTL+ I LE SGG Sbjct: 2 IEFQRLHKSYAVAGRAISALQPLDLTIQEGEVFGIIGHSGAGKSTLIRMINRLEDPSGGR 61 Query: 62 ILVDDADIS-----GMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEV 116 +L+ D++ G+ R I M+FQ + L + +V N+AF L++ P A+ID V Sbjct: 62 LLIAGEDVTALETAGLRTLRRRIGMIFQHFNLLSSRTVASNVAFPLELAGTPRAQIDARV 121 Query: 117 ARVSKLLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRT 176 A + + + ++ + P QLSGGQ+QRV + RALA P+I L DE S LD + + Sbjct: 122 AELLQTVGLQAHADKYPAQLSGGQKQRVGIARALATGPQILLCDEATSALDPQTTASVLA 181 Query: 177 EMKLMHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFI 236 + +++ L T V +TH+ + D+VAV+ G + + G D++ +P + F+ Sbjct: 182 LLSKINRELGLTIVLITHEMDVIRRVCDRVAVLDAGEMVEMGPVTDVFLHPQHPTTRRFV 241 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 335 Length adjustment: 29 Effective length of query: 357 Effective length of database: 306 Effective search space: 109242 Effective search space used: 109242 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory