Align D-mannitol and D-mannose transporter (MFS superfamily) (characterized)
to candidate WP_057508914.1 ABB28_RS12315 sugar MFS transporter
Query= reanno::SB2B:6936374 (413 letters) >NCBI__GCF_001431535.1:WP_057508914.1 Length = 438 Score = 387 bits (994), Expect = e-112 Identities = 215/419 (51%), Positives = 280/419 (66%), Gaps = 30/419 (7%) Query: 6 STTPQNGSAAPAQSHQQLLFGAMTSLFFIWGFITALNDILIPHLKGIFDLSYTQAMLVQF 65 +TTP G A P + L G T++FF+WGF+T LNDILIPHLK +F+L+Y +AMLVQF Sbjct: 10 NTTPGQG-APPVNTRMAL--GVATTIFFMWGFLTCLNDILIPHLKAVFELNYARAMLVQF 66 Query: 66 CFFGAYFLVSPLAGVLIARIGYLRGIIFGLSTMATGCLLFYPASSLEQYALFLLALFVLA 125 FFGAYFL+S AG L+A +GY +GI+ GL G L F+PA+ L +Y+ FL ALFVLA Sbjct: 67 TFFGAYFLMSLPAGRLVAHLGYKKGIVAGLLIAGVGALGFWPAAELREYSAFLGALFVLA 126 Query: 126 SGITILQVSANPFVARLGPERTAASRLNLAQALNSLGHTLGPLFGSLLIFGAA------- 178 +GIT+LQV+ANP+VA LGP T++SRL LAQALNSLG + P+FG LLI G Sbjct: 127 TGITVLQVAANPYVALLGPVETSSSRLTLAQALNSLGTAIAPIFGGLLILGNTVKSADEI 186 Query: 179 ------------AGTHEAVQLPYLLLAAVIGIIAVGFIFL------GGKVKHADMGVDHR 220 A ++VQ PY+ LA + ++A+ F++L + D G Sbjct: 187 NALSVAEQAAYRAAEAQSVQGPYIGLAIALVLLAL-FVYLFRLPTLSESAEKVDDGPQQS 245 Query: 221 HKGSLLSHKRLLLGALAIFLYVGAEVSIGSFLVNYFAEPSIGGLDEKSAAELVSWYWGGA 280 + G+ L H+ LL L IF YVGAEVSIGSFLVNY + P+IGG E+ A VS YW A Sbjct: 246 Y-GAALRHRHLLFAVLGIFFYVGAEVSIGSFLVNYLSMPTIGGFTEQQATHYVSAYWTMA 304 Query: 281 MIGRFAGAALTRRFNPAMVLAANAVFANLLLMLTIVSSGELALVAVLAVGFFNSIMFPTI 340 MIGRFAG+AL R++P +LA A LLL T+ SSG++AL +V+A+G FNSIMFPTI Sbjct: 305 MIGRFAGSALLTRYSPRHMLALFAGINVLLLGTTMASSGQVALYSVVAIGLFNSIMFPTI 364 Query: 341 FTLAIEGLGELTSRGSGLLCQAIVGGALLPVIQGVVADNVGVQLSFIVPTFCYFYICWY 399 F L IE LG LT++ S LL AIVGGAL+P +QGV+AD++G+Q SFI+P CY Y+ ++ Sbjct: 365 FALGIERLGPLTNKASSLLIMAIVGGALVPYLQGVLADHIGLQPSFILPLLCYGYVIFF 423 Lambda K H 0.329 0.142 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 530 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 413 Length of database: 438 Length adjustment: 32 Effective length of query: 381 Effective length of database: 406 Effective search space: 154686 Effective search space used: 154686 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory