Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_057508923.1 ABB28_RS12365 phosphoglycerate dehydrogenase
Query= BRENDA::O66939 (334 letters) >NCBI__GCF_001431535.1:WP_057508923.1 Length = 414 Score = 123 bits (309), Expect = 7e-33 Identities = 97/326 (29%), Positives = 160/326 (49%), Gaps = 31/326 (9%) Query: 6 TSVPQEDVP-FYQEALKDLSLKIYTT--------DVSKVPENELKK----AELISVFVYD 52 TS P++D+ E + ++ ++T +PE+ELK A ++ + Sbjct: 6 TSYPKQDIRVLLLEGVSQTAVDVFTAAGYSQIELHSKALPEDELKARIADAHIVGIRSRS 65 Query: 53 KLTEELLSKMPRLKLIHTRSVGFDHIDLDYCKKKGILVTHIPAYSPESVAEHTFAMILTL 112 +L+ E+L++ R+ + +G + +DLD + GI V + P + SVAE A + L Sbjct: 66 QLSAEVLAEAKRVIAVGCFCIGTNQVDLDAAELAGIPVFNAPYSNTRSVAELVIAEAIML 125 Query: 113 VKRLKRIEDRVKKLNFSQDSEILARELNRLTLGVIGTGRIGSRVAMYGLAFGMKVLCYDV 172 + + + + +S+ S + E+ TLG+IG G IG++V + + G++V+ +DV Sbjct: 126 TRGIPQKNAECHRGGWSK-SAAGSHEVRGKTLGIIGYGHIGTQVGVLAESLGLQVIFHDV 184 Query: 173 VKREDLKEKGCVYTSLDELLKESDVISLHVPYTKETHHMINEERISLMKDGVYLINTARG 232 + L SLD+LL+ SD+I+LHVP T T MI ++ M+ G ++IN ARG Sbjct: 185 EAKLALGNARAA-VSLDDLLERSDIITLHVPETPATQWMIGATELAKMRRGAHVINAARG 243 Query: 233 KVVDTDALYRAYQRGKFSGLGLDVFEDEEILILKKYTEGKATDKNLKILE--LACKDNVI 290 +VD AL A G G LDVF E N + E L DNVI Sbjct: 244 TIVDIAALDAALGSGHIGGAALDVFPVE-------------PKGNGDVFESPLTAHDNVI 290 Query: 291 ITPHIAYYTDKSLERIR-EETVKVVK 315 +TPH+ T ++ + I E K+V+ Sbjct: 291 LTPHVGGSTLEAQDNIGIEVAAKLVR 316 Lambda K H 0.319 0.138 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 414 Length adjustment: 30 Effective length of query: 304 Effective length of database: 384 Effective search space: 116736 Effective search space used: 116736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory