Align Solute-binding protein Bpro_3107 (characterized)
to candidate WP_057509040.1 ABB28_RS12855 C4-dicarboxylate ABC transporter
Query= SwissProt::Q128M1 (330 letters) >NCBI__GCF_001431535.1:WP_057509040.1 Length = 333 Score = 244 bits (623), Expect = 2e-69 Identities = 125/324 (38%), Positives = 200/324 (61%), Gaps = 9/324 (2%) Query: 13 SAALAALLAGLGMGAAQATE-------FRSADTHNADDYPTVAAVKYMGELLEKKSGGKH 65 + +L AL A +G ++A + + D H AD YPTV AVK++G+ LE+++GG+ Sbjct: 9 ATSLGALAAPALIGCSKAGDSVAGGHLLTATDVHVAD-YPTVTAVKWIGQTLERETGGRL 67 Query: 66 KIKVFNKQALGSEKETIDQVKIGALDFTRVNVGPMNAICPLTQVPTMPFLFSSIAHMRKS 125 +++ ++ LG E E ID + GA+D TRV G +N PLTQ +P++F S+AHMR + Sbjct: 68 RLRQYHSGQLGRESEAIDMARFGAIDITRVYSGALNNAFPLTQALCLPYVFDSVAHMRAA 127 Query: 126 LDGPVGDEILKSCESAGFIGLAFYDSGARSIY-AKKPIRTVADAKGLKIRVQQSDLWVAL 184 LDG V D +L+ ES +GLA YDSGAR Y K PI D +GLK+RV SD+++ L Sbjct: 128 LDGGVADAVLRGFESRDLVGLAIYDSGARCFYNTKHPIVAPQDLRGLKLRVASSDIFIQL 187 Query: 185 VSAMGANATPMPYGEVYTGLKTGLIDAAENNIPSFDTAKHVEAVKVYSKTEHSMAPEILV 244 + GAN TPM G+ ++G++T +ID AENN+ SF +++H EA +S+++HS AP++L+ Sbjct: 188 MRLFGANPTPMSLGDTFSGMETHMIDGAENNMRSFHSSRHFEAAHYWSQSDHSYAPDVLL 247 Query: 245 MSKIIYDKLPKAEQDMIRAAAKESVAFERQKWDEQEAKSLANVKAAGAEIVEVDKKSFQA 304 MS+ YD+L ++ ++ A+ SV R++WD E + V G + EVD +F+ Sbjct: 248 MSRASYDQLRPDDRQLLLETARASVKVMREQWDASEDAARKAVVDFGVKTNEVDLVAFRK 307 Query: 305 VMGPVYDKFMTTPDMKRLVKAVQD 328 P+ +++ P++ +V ++D Sbjct: 308 AADPLLQEYLKQPELAAMVSRIRD 331 Lambda K H 0.316 0.130 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 333 Length adjustment: 28 Effective length of query: 302 Effective length of database: 305 Effective search space: 92110 Effective search space used: 92110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory