Align Senescence marker protein-30 family protein (characterized, see rationale)
to candidate WP_057509054.1 ABB28_RS13170 SMP-30/gluconolactonase/LRE family protein
Query= uniprot:Q888H2 (294 letters) >NCBI__GCF_001431535.1:WP_057509054.1 Length = 308 Score = 154 bits (390), Expect = 2e-42 Identities = 103/294 (35%), Positives = 140/294 (47%), Gaps = 11/294 (3%) Query: 3 AELIVDAQNATGESPVWSVREQALYWVDIPNGELHRWDSSQDRTRSWKAPQMLACIAADS 62 A L D++ GES W RE+ L+W DI + R + + W P + +A Sbjct: 13 AALAFDSRCTLGESITWCARERVLWWTDINGRRIWRGNPDTGNAQWWSTPGRVGSLALCE 72 Query: 63 RGGWIAGMENGLYHLQPCDD---GSLISTLLASVEHAQTGMRFNDGRCDRQGRFWAGTML 119 G + GME LY P + L + V +R NDGR DR G F G + Sbjct: 73 SGRLLLGMEKALYFADPSREEPGAGLNCEQVCEVPMDGAALRINDGRLDRAGNFVFGCIN 132 Query: 120 MDMAAGAVVGALYRYSAGQKTLEAQLKDLIVPNGLAFSPDGKTMYLSDSHPAVQKIWAFD 179 D A A ++YS Q L+ + + NG+ F PDG+ MY DS +I Sbjct: 133 EDPAR-ARAARFHQYSIAQGLRALALEPVAIANGICFDPDGQGMYYCDSLQG--RIMHAG 189 Query: 180 YDTDSGTPHDRRLFVDMNNYLGRPDGAAIDADGCYWICGNDAGLVHRFTPNGKLDRSLVV 239 YD + T D R+F ++ PDGA +DADG W AG V R++ G++DR L V Sbjct: 190 YDAATATVSDPRVFAVIDGG-AEPDGAVVDADGRVWGAQWGAGRVVRYSAAGEVDRILPV 248 Query: 240 PVKKPAMCAFGGPNLDTLFVTSIRPGGD---LSDQPLAGGVFALR-PGVKGLEE 289 P +P AF G L TL+VTS R G D L DQP +GGVF + G +GL + Sbjct: 249 PALQPTCVAFAGDGLGTLYVTSARDGLDVAMLQDQPTSGGVFRVSLEGARGLPD 302 Lambda K H 0.320 0.138 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 356 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 308 Length adjustment: 27 Effective length of query: 267 Effective length of database: 281 Effective search space: 75027 Effective search space used: 75027 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory