Align predicted periplasmic 3-ketoglycoside hydrolase (DUF1080) (characterized)
to candidate WP_057509066.1 ABB28_RS13230 DUF1080 domain-containing protein
Query= reanno::Pedo557:CA265_RS22975 (260 letters) >NCBI__GCF_001431535.1:WP_057509066.1 Length = 247 Score = 248 bits (634), Expect = 7e-71 Identities = 130/257 (50%), Positives = 163/257 (63%), Gaps = 16/257 (6%) Query: 6 LLFIPALFAGQAMAQDKKPDPAKDPKTTEVWEPVP-KVVTPGKLPQDAPSDATILFGGRN 64 LL L A + DPA+DP TEVW+PVP V TP APSDAT+LF G++ Sbjct: 5 LLVTAGLLAAIPVFAQAGGDPARDPARTEVWKPVPASVATPAG---GAPSDATVLFDGKD 61 Query: 65 LDAWHSVKDPSKPAEWTIDDGFFTVKKGTGNIETNKKFTDYQLHMEWKIPENISG-EGQA 123 + AW S + P W + DG TV G+ I T ++F D QLH+EW+ P +G +GQ Sbjct: 62 VSAWES--EQGGPVPWRLADGALTVVPGSKGIRTRQRFCDIQLHVEWRTPAATAGFDGQN 119 Query: 124 RGNSGVFLASTGGGDNGYEIQIMDAYNNKTYVNGQTGSVYKQAIPLANANKKPGEWQYYD 183 RGNSGVFL YE+Q++D+YNN TY NGQ GS+YKQA+PL NA++ PG+WQ YD Sbjct: 120 RGNSGVFLQDL------YELQVLDSYNNPTYANGQAGSIYKQAMPLVNASRAPGQWQAYD 173 Query: 184 IIWNAPRFNEDGTVQKPASVTVFLNGVLLQNGFVLKGETRYIGAPEYKKHGPSSIKLQDH 243 IIW APRF+ G + PA +TV NGVL+Q+ VL G T YIGAP Y H + I LQ+H Sbjct: 174 IIWKAPRFSPGGGLVSPARITVLHNGVLVQDDTVLAGRTEYIGAPSYAPHDCAPISLQEH 233 Query: 244 GDPSPAISYRNIWVREL 260 A+SYRNIWVREL Sbjct: 234 ---DSAVSYRNIWVREL 247 Lambda K H 0.314 0.134 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 247 Length adjustment: 24 Effective length of query: 236 Effective length of database: 223 Effective search space: 52628 Effective search space used: 52628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory