Align 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 (characterized)
to candidate WP_057509083.1 ABB28_RS13320 alpha-ketoacid dehydrogenase subunit beta
Query= SwissProt::Q5SLR3 (324 letters) >NCBI__GCF_001431535.1:WP_057509083.1 Length = 355 Score = 299 bits (766), Expect = 6e-86 Identities = 151/320 (47%), Positives = 220/320 (68%), Gaps = 1/320 (0%) Query: 4 MTMVQALNRALDEEMAKDPRVVVLGEDVGKRGGVFLVTEGLLQKYGPDRVMDTPLSEAAI 63 +T+++A+ +AL E+ D V+VLGEDVG GGVF T GL Q++G +R++DTPL E I Sbjct: 33 ITLIEAITQALAWELEHDSSVLVLGEDVGVNGGVFRATAGLQQRFGANRILDTPLDETTI 92 Query: 64 VGAALGMAAHGLRPVAEIQFADYIFPGFDQLVSQVAKLRYRSGGQFTAPLVVRMPSGGGV 123 G +G+AA G++P+AE QF +++P D ++ A+LR R+ G+ P+V+R+P GGG+ Sbjct: 93 AGLTIGLAAQGMKPIAEAQFDGFMYPMVDHIICHAARLRTRTRGRLHCPMVLRVPWGGGI 152 Query: 124 RGGHHHSQSPEAHFVHTAGLKVVAVSTPYDAKGLLKAAIRDEDPVVFLEPKRLYRSVKEE 183 R HHS++ E+ F + GL+VV S+P A GLL AAIR+ DPV+++EPKR+YR KE Sbjct: 153 RAPEHHSEANESIFTNVPGLRVVLPSSPQRAYGLLLAAIREPDPVIYMEPKRIYRQYKEV 212 Query: 184 VPEEDYTLPIGKAALRREGKDLTLIGYGTVMPEVLQAAAELAKAGVSAEVLDLRTLMPWD 243 V + LP+ + R+G D+TL+ +G + E L+AA +LA G+SAEV+D+ TL P D Sbjct: 213 VVNDGEALPLDVCFVLRDGTDVTLVTWGAQVKEALEAADKLAGEGISAEVIDVATLRPLD 272 Query: 244 YEAVMNSVAKTGRVVLVSDAPRHASFVSEVAATIAEDLLDMLLAPPIRVTGFDTPYP-YA 302 + + SVAKTGR V+V +AP+ A F +E+AA +AE+ L LLAP RVTG+DT P + Sbjct: 273 FATIAESVAKTGRCVIVQEAPKTAGFGAEIAARLAEESLYDLLAPVERVTGYDTHIPLFR 332 Query: 303 QDKLYLPTVTRILNAAKRAL 322 + YLP+V RI+ AAKRA+ Sbjct: 333 LEMKYLPSVERIVAAAKRAV 352 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 355 Length adjustment: 28 Effective length of query: 296 Effective length of database: 327 Effective search space: 96792 Effective search space used: 96792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory