Align Putative branched-chain alpha keto acid dehydrogenase E1 subunit beta (characterized, see rationale)
to candidate WP_057509083.1 ABB28_RS13320 alpha-ketoacid dehydrogenase subunit beta
Query= uniprot:G1UHX5 (328 letters) >NCBI__GCF_001431535.1:WP_057509083.1 Length = 355 Score = 280 bits (716), Expect = 4e-80 Identities = 148/315 (46%), Positives = 194/315 (61%), Gaps = 1/315 (0%) Query: 4 ITMAKALNTALRDALRDDPRTILFGEDIGALGGVFRITDGLAAEFGDERCFDTPLAESAI 63 IT+ +A+ AL L D ++ GED+G GGVFR T GL FG R DTPL E+ I Sbjct: 33 ITLIEAITQALAWELEHDSSVLVLGEDVGVNGGVFRATAGLQQRFGANRILDTPLDETTI 92 Query: 64 LGTAVGMAMYGYRPVVEMQFDAFAYPAFEQLVSHVAKLRNRTRGAIGLPLTIRIPYGGGI 123 G +G+A G +P+ E QFD F YP + ++ H A+LR RTRG + P+ +R+P+GGGI Sbjct: 93 AGLTIGLAAQGMKPIAEAQFDGFMYPMVDHIICHAARLRTRTRGRLHCPMVLRVPWGGGI 152 Query: 124 GGVEHHSDSSEIYYMATPGLTVVTPATAADAYSLLRRSIASPDPVVFLEPKRLYWR-KEA 182 EHHS+++E + PGL VV P++ AY LL +I PDPV+++EPKR+Y + KE Sbjct: 153 RAPEHHSEANESIFTNVPGLRVVLPSSPQRAYGLLLAAIREPDPVIYMEPKRIYRQYKEV 212 Query: 183 LGLPVDTGPLGSAVIRRHGTHATLIAYGPAVTTALEAAEAAAEHGWDLEVIDLRTLMPLD 242 + + PL + R GT TL+ +G V ALEAA+ A G EVID+ TL PLD Sbjct: 213 VVNDGEALPLDVCFVLRDGTDVTLVTWGAQVKEALEAADKLAGEGISAEVIDVATLRPLD 272 Query: 243 DATVCASVRRTGRAVVVHEAHGFAGPGAEIAARITERCFYHLEAPVRRVTGFDVPYPPPL 302 AT+ SV +TGR V+V EA AG GAEIAAR+ E Y L APV RVTG+D P Sbjct: 273 FATIAESVAKTGRCVIVQEAPKTAGFGAEIAARLAEESLYDLLAPVERVTGYDTHIPLFR 332 Query: 303 LERHYLPGVDRILDA 317 LE YLP V+RI+ A Sbjct: 333 LEMKYLPSVERIVAA 347 Lambda K H 0.322 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 355 Length adjustment: 29 Effective length of query: 299 Effective length of database: 326 Effective search space: 97474 Effective search space used: 97474 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory