Align anthranilate synthase (subunit 2/2) (EC 4.1.3.27) (characterized)
to candidate WP_057509109.1 ABB28_RS13450 aminodeoxychorismate/anthranilate synthase component II
Query= BRENDA::P20576 (201 letters) >NCBI__GCF_001431535.1:WP_057509109.1 Length = 192 Score = 268 bits (684), Expect = 6e-77 Identities = 129/192 (67%), Positives = 152/192 (79%) Query: 1 MLLMIDNYDSFTYNLVQYFGELKAEVKVVRNDELSVEQIEALAPERIVLSPGPCTPNEAG 60 ML MIDNYDSFTYNLVQY L AEVKVVRND ++V++I A P RIV+SPGPCTPNEAG Sbjct: 1 MLWMIDNYDSFTYNLVQYLQTLGAEVKVVRNDAMTVDEIAAQKPGRIVISPGPCTPNEAG 60 Query: 61 VSLAVIERFAGKLPLLGVCLGHQSIGQAFGGEVVRARQVMHGKTSPIHHKDLGVFAGLAN 120 +SL +I+R P+LGVCLGHQ IGQ +GG V+RA +MHGKTSPI H+ GVFAGL + Sbjct: 61 ISLELIQRLGPTTPILGVCLGHQGIGQVYGGTVIRAGNIMHGKTSPIRHEGKGVFAGLPD 120 Query: 121 PLTVTRYHSLVVKRESLPECLEVTAWTQHADGSLDEIMGVRHKTLNVEGVQFHPESILTE 180 TRYHSLVV + LP CLEVTAWT++ DGS++EIMG+RH+ VEGVQFHPESILTE Sbjct: 121 RYQATRYHSLVVDKTRLPACLEVTAWTENEDGSVEEIMGLRHREHPVEGVQFHPESILTE 180 Query: 181 QGHELLANFLRQ 192 GH LL NFL++ Sbjct: 181 HGHALLRNFLQR 192 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 192 Length adjustment: 20 Effective length of query: 181 Effective length of database: 172 Effective search space: 31132 Effective search space used: 31132 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate WP_057509109.1 ABB28_RS13450 (aminodeoxychorismate/anthranilate synthase component II)
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
../bin/blast/fastacmd -i /tmp/list.1079.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.1079.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.