Align 3-Hydroxy-3-isohexenylglutaryl-CoA lyase (EC 4.1.3.26) (characterized)
to candidate WP_057509134.1 ABB28_RS13610 hydroxymethylglutaryl-CoA lyase
Query= BRENDA::Q9I2A0 (300 letters) >NCBI__GCF_001431535.1:WP_057509134.1 Length = 297 Score = 352 bits (902), Expect = e-102 Identities = 173/292 (59%), Positives = 218/292 (74%) Query: 7 VRLVEVGPRDGLQNEKQPIEVADKIRLVDDLSAAGLDYIEVGSFVSPKWVPQMAGSAEVF 66 VR+VEVGPRDGLQNEKQP+ ADKI L+D LSA GL IE SFVSP+WVPQ+A +A+V+ Sbjct: 5 VRIVEVGPRDGLQNEKQPVSTADKIALIDRLSATGLRSIEATSFVSPRWVPQLADAADVY 64 Query: 67 AGIRQRPGVTYAALAPNLKGFEAALESGVKEVAVFAAASEAFSQRNINCSIKDSLERFVP 126 AGI +RPGV Y L PN +G+ AL +GV+EVAVF AASE F++ N N I +SL RF P Sbjct: 65 AGIHRRPGVAYPVLVPNEQGYARALAAGVQEVAVFTAASETFNRTNTNAGIDESLARFEP 124 Query: 127 VLEAARQHQVRVRGYISCVLGCPYDGDVDPRQVAWVARELQQMGCYEVSLGDTIGVGTAG 186 +L A VRVRGY+S VLGCPY G+V +V VAR L MGCYE+SLGDTIGVGT Sbjct: 125 ILRRAADDGVRVRGYVSTVLGCPYQGEVPVSEVVRVARALHGMGCYEISLGDTIGVGTPR 184 Query: 187 ATRRLIEAVASEVPRERLAGHFHDTYGQALANIYASLLEGIAVFDSSVAGLGGCPYAKGA 246 R ++EAVA++VP + LA HFHDTYGQA+ANI + + G+ V DS+V+G GGCPYAKGA Sbjct: 185 KARAMLEAVAADVPMQALAVHFHDTYGQAVANIASCVEAGVRVVDSAVSGAGGCPYAKGA 244 Query: 247 TGNVASEDVLYLLNGLEIHTGVDMHALVDAGQRICAVLGKSNGSRAAKALLA 298 +GNVASED +YLL+G+ + TGV++ L + G+ + A+ G+ GSR KA+ A Sbjct: 245 SGNVASEDAVYLLHGMGLQTGVELELLAEIGRWLSALFGRPTGSRVGKAMAA 296 Lambda K H 0.318 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 297 Length adjustment: 27 Effective length of query: 273 Effective length of database: 270 Effective search space: 73710 Effective search space used: 73710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory