Align Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized)
to candidate WP_057509355.1 ABB28_RS14795 amino acid permease
Query= TCDB::Q2VQZ4 (536 letters) >NCBI__GCF_001431535.1:WP_057509355.1 Length = 460 Score = 201 bits (511), Expect = 5e-56 Identities = 133/419 (31%), Positives = 211/419 (50%), Gaps = 21/419 (5%) Query: 37 LKNRHMQMIAIGGAIGAGLFVGSGGALQKGGPAALLIGYLIIGIMLLCTCLALAEMAVLY 96 LK R + M+ +G AIGAGLF+GSG +Q GPA LL YL+ G +++ AL EMA Sbjct: 20 LKPRQLIMMGLGSAIGAGLFLGSGVGVQLAGPAVLL-SYLVAGALVIIVMNALGEMAANK 78 Query: 97 PVNGAFFTYIVRFVDPSWGFAMGWQYALAWLTVLPFELIAASITIRFWREDINMAVWVSV 156 P +GAF Y + P+ G +GW + + + V+ E + A+ + +++ + Sbjct: 79 PTSGAFSVYAADALGPTAGATVGWLWWVQLVIVIAAEAVGAAGLLATVWTGLSVPMAALA 138 Query: 157 FLVVLMGIQIFGVRGYGEVEFVLSIIKICACVGFIILGIVINCGGVGDQGYIGVKYWRDP 216 F++ I + GV+ +GE EF +I+K+ A +GFI +G + G + D G+ + Sbjct: 139 FMLFFTAINLLGVKNFGEFEFWFAILKVAAILGFIAIGAALLLGWLPDATSPGLSNFTGN 198 Query: 217 GAF--TSFKGFCAVFVVAAFSFGGTEMVGLAAAESANPRKSIPMASKQVFWRIAIFYILN 274 G F T G A +V F+FGGTE+V +AAAE+ +P +SI A + V WRI +FYI + Sbjct: 199 GGFAPTGLAGVGAALLVVIFAFGGTEIVAVAAAETEDPERSIARAIRTVAWRILVFYIGS 258 Query: 275 LFIVGLILPANDPRLMGASGANTKASPFVLAIQDAGIKVLPSIMNAVITVAVLSVANSCT 334 L ++ ++P L SPF ++ A I + + V +A+LS N+ Sbjct: 259 LSVIIAVVPWTSEAL---------KSPFAAVLEAANIPGAGTAITLVAVIALLSALNANL 309 Query: 335 FGSTRTIQAMAERNMAPNFFKYIDSKGRPLYCVILQIAFGLLAYIGAAPQGMEIFGWLLA 394 +G++R I ++A+R AP + D + P+ V+ + FG A + + LL Sbjct: 310 YGASRMIFSLAQRREAPAVLGWADRRQVPVLAVLASVLFGFAATVMELVFPDRVLPVLLN 369 Query: 395 LTGLGFLFVWGSICLAHIRMRAGMKAQGINLGLIPYKTPFGVAGS--YLGLGLNILALI 451 + G L VW L+ + +R G+ L PF +A L L ILALI Sbjct: 370 IVGSTCLLVWTLSLLSQLVLRRRADRAGVAL-------PFRMAAFPWLTALALAILALI 421 Lambda K H 0.327 0.142 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 611 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 536 Length of database: 460 Length adjustment: 34 Effective length of query: 502 Effective length of database: 426 Effective search space: 213852 Effective search space used: 213852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory