Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate WP_057509365.1 ABB28_RS14840 glutathione S-transferase family protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5292 (211 letters) >NCBI__GCF_001431535.1:WP_057509365.1 Length = 219 Score = 59.7 bits (143), Expect = 4e-14 Identities = 57/194 (29%), Positives = 87/194 (44%), Gaps = 11/194 (5%) Query: 9 STSSYRVRIALALKGLDYQALPVNLIAAPGGEHRQPAYLAINPQGRVPALRTDEGALLVQ 68 S + ++VR+ L G Y+ + V+ + G+ P +LA+NP +VP + D+G +L + Sbjct: 16 SGNCHKVRLLLEQLGTRYRWVEVD---SAHGQTHAPEFLALNPNAKVPVVVRDDGRVLPE 72 Query: 69 SPAIIEYLEERYPQVPLLSADLTVRAHERGVAALIGCDIHPLHNVSVLNKLRQW-GHDET 127 S AI+ +L E P LS+D RA P V+V + W G D Sbjct: 73 SNAILFWLAE---GTPFLSSDGWERAQTLRWMFFEQYSHEPY--VAVARFICGWTGADSP 127 Query: 128 QVTEW--IGHWISQGLAAVEQLMGDDGYCFGAAPGLADVYLIPQLYAAERFNVSLQAYPR 185 + E + + LA +EQ +G + GAA G+AD+ L A VSLQ YP Sbjct: 128 RRAELPRLRERSAAALAVMEQHLGHARWFSGAAYGIADIALFAYTDVAGDGGVSLQPYPA 187 Query: 186 IRRVAALAAGHPAF 199 + P F Sbjct: 188 VVAWLQRVRSQPGF 201 Lambda K H 0.320 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 211 Length of database: 219 Length adjustment: 22 Effective length of query: 189 Effective length of database: 197 Effective search space: 37233 Effective search space used: 37233 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory