Align 4-(gamma-glutamylamino)butanal dehydrogenase (EC 1.2.1.99) (characterized)
to candidate WP_057687530.1 ABB28_RS16890 betaine-aldehyde dehydrogenase
Query= BRENDA::P23883 (495 letters) >NCBI__GCF_001431535.1:WP_057687530.1 Length = 490 Score = 325 bits (834), Expect = 2e-93 Identities = 175/480 (36%), Positives = 270/480 (56%), Gaps = 11/480 (2%) Query: 21 RLFINGEYTAAAENETFETVDPVTQAPLAKIARGKSVDIDRAM-SAARGVFERGDWSLSS 79 +L+I+G+ A +TF++++P T +A++ D++RA+ SAA G + W+ + Sbjct: 8 QLYIHGKLVDATSGKTFQSINPATGKVIAEVQIANQADVERAVASAAEG---QKVWAAMT 64 Query: 80 PAKRKAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKVY 139 +R +L + DL+ + LA LETLDTGK + + DI A + +YA + Sbjct: 65 AMERSRILRRAVDLLRERNDALAQLETLDTGKALSETTTVDIVTGADVLEYYAGLATAIE 124 Query: 140 GEVATTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVILKPSEKSPLS 199 G REP+GV+A I WN+P+ + WK PALAAGN+++ KPSE +PL+ Sbjct: 125 GNQVPLRESSFFYTRREPLGVVAGIGAWNYPVQIALWKSAPALAAGNAMVFKPSEVTPLT 184 Query: 200 AIRLAGLAKEAGLPDGVLNVVTGFGHEAGQALSRHNDIDAIAFTGSTRTGKQLLKDAGDS 259 I LA + EAG+PDGV NVV G G E GQ L+ H I+ I+FTG TGK+++ A S Sbjct: 185 VIELAKIYTEAGVPDGVFNVVQGPGREVGQWLTEHPVIEKISFTGGVETGKKVMASAASS 244 Query: 260 NMKRVWLEAGGKSANIVFADCPDLQQAASATAAGIFYNQGQVCIAGTRLLLEESIADEFL 319 ++K V +E GGKS +V D L++AA F++ GQVC GTR+ + + F Sbjct: 245 SLKEVTMELGGKSP-LVICDDAQLERAADIAVMANFFSSGQVCTNGTRVFVPRPMLAAFE 303 Query: 320 ALLKQQAQNWQPGHPLDPATTMGTLIDCAHADSVHSFIREGESKGQLLLDGRNAGLAAAI 379 A + ++ + + G P D T G + AH D+V I G+ +G LL G A+ Sbjct: 304 AAVVERVKRIRIGDPQDAQTNFGPMTSFAHMDNVLRLIETGKREGARLLTGGGRATDGAL 363 Query: 380 G------PTIFVDVDPNASLSREEIFGPVLVVTRFTSEEQALQLANDSQYGLGAAVWTRD 433 PT+F D + ++ REEIFGPV+ + + EE+ + AND+ +GL A V + D Sbjct: 364 AKGAYVLPTVFSDCRDDMTIVREEIFGPVMSILAYDDEEEVIARANDTHFGLAAGVVSND 423 Query: 434 LSRAHRMSRRLKAGSVFVNNYNDGDMTVPFGGYKQSGNGRDKSLHALEKFTELKTIWISL 493 ++RAHR+ RL+AG ++N + + +P GGYKQSG GR+ + L +T +K++ + L Sbjct: 424 IARAHRIIHRLEAGICWINTWGESPAEMPVGGYKQSGVGRENGISTLAHYTRIKSVQVEL 483 Lambda K H 0.317 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 560 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 490 Length adjustment: 34 Effective length of query: 461 Effective length of database: 456 Effective search space: 210216 Effective search space used: 210216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory