Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_057687599.1 ABB28_RS17325 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >NCBI__GCF_001431535.1:WP_057687599.1 Length = 315 Score = 90.9 bits (224), Expect = 3e-23 Identities = 65/226 (28%), Positives = 117/226 (51%), Gaps = 9/226 (3%) Query: 6 LKVQQLSVAY-GGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHI 64 L+V+ L Y G A+KG+ LEV G+ L+G NGAGK+T + ++ + S +G + Sbjct: 11 LRVRDLRKTYDNGTVALKGVSLEVAPGDFFALLGPNGAGKSTLIGIVSSLVNLS--DGQV 68 Query: 65 EYLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMG--AYTSDDKGQIAADIDK 122 E G L G++S + + +VP+ F ++L+ + D+ + ++ Sbjct: 69 EVFGTDLVGERSASM--RLIGLVPQEIN-FNLFEKPFDILVNYAGFYGVDRAEAEKRAEE 125 Query: 123 WFAVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFEV 182 L E+A M+ TLSGG ++ L +ARA+M+ P+LL+LDEP+ G+ + ++ V Sbjct: 126 ELKR-AHLWEKAQVMSRTLSGGMKRRLMIARAMMTRPRLLILDEPTAGVDIEIRRDMWRV 184 Query: 183 IRNVSAQGITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQML 228 ++ ++ G TI+L + A ++ G I QG +++L Sbjct: 185 LKEINTAGTTIILTTHYLEEAEHLCRNLAIINHGQIVTQGPMRELL 230 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 241 Length of database: 315 Length adjustment: 25 Effective length of query: 216 Effective length of database: 290 Effective search space: 62640 Effective search space used: 62640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory