Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_057687611.1 ABB28_RS17405 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >NCBI__GCF_001431535.1:WP_057687611.1 Length = 587 Score = 73.9 bits (180), Expect = 6e-18 Identities = 65/218 (29%), Positives = 105/218 (48%), Gaps = 19/218 (8%) Query: 20 AVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHIEYLGQPLKGKKSFEL 79 A++ L V GE V L+G +GAGK+T L+ + G + G L+ L Sbjct: 364 ALEHFSLHVRHGETVALVGPSGAGKSTVLQLLLRFHDPR--SGALSVDGIDLRAMDPAAL 421 Query: 80 VKDKLAMVPEGRGVFTRMSIQENLLMGAYTSDDK----GQIAADIDKWFAVFP-----RL 130 + +LA+VP+ +F S ++N+ G + D AA+ D++ P L Sbjct: 422 -RAQLALVPQQPTLFAA-SARDNIRYGRLDASDAEVEAAARAAEADEFLRALPDGYDSEL 479 Query: 131 KERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFEVIRNVSAQG 190 ER A+ LSGG+QQ +A+ARAL+ +LLLDE + L + + + + A Sbjct: 480 GERGAR----LSGGQQQRIAIARALLKDAPILLLDEATSALDAQSERAVQQALERLMAGR 535 Query: 191 ITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQML 228 T+++ + A + A R VM+ G I QG +Q+L Sbjct: 536 TTLVIAHRLATIL--KADRIVVMDHGRIIAQGTHEQLL 571 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 587 Length adjustment: 30 Effective length of query: 211 Effective length of database: 557 Effective search space: 117527 Effective search space used: 117527 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory