Align 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase; EC 2.3.1.16 (characterized)
to candidate WP_058929093.1 AU252_RS00785 acetyl-CoA acetyltransferase
Query= SwissProt::O32177 (391 letters) >NCBI__GCF_001484605.1:WP_058929093.1 Length = 405 Score = 314 bits (804), Expect = 3e-90 Identities = 178/415 (42%), Positives = 245/415 (59%), Gaps = 39/415 (9%) Query: 1 MKEAVIVSGARTPVGKAKKGSLATVRPDDLGAICVKETLKRAGGYEG-NIDDLIIGCATP 59 M EAVIVS AR+P+G+A KGSL +RPDDL A V+ L + + +I+DL++GC P Sbjct: 1 MTEAVIVSIARSPIGRAMKGSLVDMRPDDLAAQMVRAALDKVPALDPTDINDLLLGCGLP 60 Query: 60 EAEQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAES 119 EQG NM RN+ G + +P T+ RYCSS LQ+ A I G D I+ G E+ Sbjct: 61 GGEQGYNMGRNVAVQLGYDF-MPGTTITRYCSSSLQTTRMALHAIKAGEGDVFISAGVET 119 Query: 120 MSQV-------------PMMGHVTRPNLALAEKAPEY------------YMSMGHTAEQV 154 +S+ P+ LA+ + Y++MG TAE V Sbjct: 120 VSRFVKGNSDSLPDTHNPLYADAQTRTEKLAQGGQTWEDPRKVGLVADTYIAMGQTAENV 179 Query: 155 AKKYGVSREDQDAFAVRSHQNAAKALAEGKFKDEIVPVEVTVTEIGEDHKPMEKQFVFSQ 214 A+ G+SRE+QD +AVRS A KA+ G ++ EI PV + V S Sbjct: 180 AQMTGISREEQDRWAVRSQNRAEKAIINGFYEREITPVT------------LPDGTVVST 227 Query: 215 DEGVRPQTTADILSTLRPAFSVDGTVTAGNSSQTSDGAAAVMLMDREKADALGLAPLVKF 274 D+G R TT + +S L+P F DGTVTAGN+ +DGAAA+++M KA LGL P+ + Sbjct: 228 DDGPRAGTTYEAVSQLKPIFRPDGTVTAGNACPLNDGAAALVIMSDTKAKELGLTPIARI 287 Query: 275 RSFAVGGVPPEVMGIGPVEAIPRALKLAGLQLQDIGLFELNEAFASQAIQVIRELGIDEE 334 S V G+ PE+MG+GP+EA RAL +AG+ + DI LFE+NEAFA Q + RELGIDE+ Sbjct: 288 VSTGVSGLSPEIMGLGPIEASKRALAIAGMGIGDIDLFEINEAFAVQVLGSARELGIDED 347 Query: 335 KVNVNGGAIALGHPLGCTGTKLTLSLIHEMKRRNEQFGVVTMCIGGGMGAAGVFE 389 K+NV+GG IALGHP G TG ++T +L++ ++ ++QFG+ TMC+GGG G A V E Sbjct: 348 KLNVSGGGIALGHPFGMTGARITATLLNNLQTYDKQFGLETMCVGGGQGMAMVLE 402 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 418 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 405 Length adjustment: 31 Effective length of query: 360 Effective length of database: 374 Effective search space: 134640 Effective search space used: 134640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_058929093.1 AU252_RS00785 (acetyl-CoA acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.3794937.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-137 445.1 0.1 1.2e-137 444.9 0.1 1.0 1 NCBI__GCF_001484605.1:WP_058929093.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_001484605.1:WP_058929093.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 444.9 0.1 1.2e-137 1.2e-137 1 385 [] 6 402 .. 6 402 .. 0.97 Alignments for each domain: == domain 1 score: 444.9 bits; conditional E-value: 1.2e-137 TIGR01930 1 ivdavRtpig.klggslkelsaedLlaavikellera.gldpekidevilGnvlqageq.aniaReaalaagl 70 iv+ +R+pig +++gsl +++++dL+a++++++l+++ ldp +i+++ lG+ l+ geq n++R++a++ g NCBI__GCF_001484605.1:WP_058929093.1 6 IVSIARSPIGrAMKGSLVDMRPDDLAAQMVRAALDKVpALDPTDINDLLLGCGLPGGEQgYNMGRNVAVQLGY 78 89*********99************************************************************ PP TIGR01930 71 pesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledqllkd 143 + +p++t++r+C+S+lq+ ++a ++ikaGe dv++++GvE++Sr ++++s ++++++ a+ + +++k NCBI__GCF_001484605.1:WP_058929093.1 79 DF-MPGTTITRYCSSSLQTTRMALHAIKAGEGDVFISAGVETVSRFVKGNSDS-LPDTHNPLYADAQTRTEKL 149 99.9********************************************99998.5777777666666655555 PP TIGR01930 144 l...............vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk 201 + ++t ++mg+tAen+a+ gisReeqD++a+rS+++a+kAi +g+ ++ei+pv++++ NCBI__GCF_001484605.1:WP_058929093.1 150 AqggqtwedprkvglvADTYIAMGQTAENVAQMTGISREEQDRWAVRSQNRAEKAIINGFYEREITPVTLPD- 221 5779************99****************************************************98. PP TIGR01930 202 kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivsaav 274 +vvs+D+g+r++tt e++++Lkp+f+ ++g tvtAgN+++lnDGAaal++ms+++akelgltp+arivs++v NCBI__GCF_001484605.1:WP_058929093.1 222 GTVVSTDDGPRAGTTYEAVSQLKPIFR-PDG-TVTAGNACPLNDGAAALVIMSDTKAKELGLTPIARIVSTGV 292 7999**********************9.69*.6**************************************** PP TIGR01930 275 agvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiAlGHPlGa 347 +g++pe+mglgp++A+++aL+ ag+ i didl+EinEAFA+qvl +++elg +d++k+Nv GG iAlGHP+G+ NCBI__GCF_001484605.1:WP_058929093.1 293 SGLSPEIMGLGPIEASKRALAIAGMGIGDIDLFEINEAFAVQVLGSARELG-IDEDKLNVSGGGIALGHPFGM 364 ***************************************************.88******************* PP TIGR01930 348 sGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 +Gari++tll++L+ +k++Gl t+CvggGqG+A++le NCBI__GCF_001484605.1:WP_058929093.1 365 TGARITATLLNNLQTYDKQFGLETMCVGGGQGMAMVLE 402 ************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (405 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 20.08 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory