Align 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_058929110.1 AU252_RS00885 enoyl-CoA hydratase/isomerase family protein
Query= metacyc::MONOMER-15953 (257 letters) >NCBI__GCF_001484605.1:WP_058929110.1 Length = 258 Score = 169 bits (429), Expect = 4e-47 Identities = 101/257 (39%), Positives = 146/257 (56%), Gaps = 3/257 (1%) Query: 4 TLSVDAPEQGVRLITLQRPEALNALNTQLLDELAAELALAEQDAETRAVVLTGS-RKAFA 62 ++ + + G+ I + RPE +NA + + +L+ D R V+TG+ KAF+ Sbjct: 2 SIDLTVSDDGIATIVMNRPERMNAFDAEAYKQLSEVWIRVRDDHAIRVAVITGAGEKAFS 61 Query: 63 AGADIKEM--AERDLVGILEDPRVAHWQRIAAFSKPLIAAVNGFCLGGGCELAMHADILI 120 AGAD+K++ A +L + + R KP+IAAVNG+CLGGG + DI I Sbjct: 62 AGADLKDLVPAPPELHDLWLTQKDQLLNRGLEIWKPVIAAVNGYCLGGGLTMLFATDIRI 121 Query: 121 AGEDARFGQPEINLGIMPGAGGTQRLLRAVGKSLAMQMVLSGQAIDARHAQRAGLVSEVT 180 A DA FG E+ G++PG G TQR++ V AM+M+L+G+ IDA A GL++EV Sbjct: 122 ACHDATFGLSEVKRGVLPGNGATQRVIDNVSYPRAMEMLLTGEPIDASKALEWGLINEVV 181 Query: 181 LPELTIERALAIARVIAQKAPLAVRLAKEALLKAEDTDLASGLRFERHAFTVLAGTADRA 240 +ER+L IAR IA APLAV+ KE +++ DLASGLR E+ +L + D Sbjct: 182 DRARLMERSLEIARQIAANAPLAVQATKELAVRSRSMDLASGLRLEQVLQRILQTSEDAV 241 Query: 241 EGIRAFQEKRRPEFTGR 257 EG +AF E+R F GR Sbjct: 242 EGPKAFAERRPAVFGGR 258 Lambda K H 0.320 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 258 Length adjustment: 24 Effective length of query: 233 Effective length of database: 234 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory