Align Alpha-ketoglutarate permease, MFS superfamily (characterized)
to candidate WP_058929211.1 AU252_RS01480 MFS transporter
Query= reanno::pseudo3_N2E3:AO353_03810 (439 letters) >NCBI__GCF_001484605.1:WP_058929211.1 Length = 434 Score = 287 bits (735), Expect = 4e-82 Identities = 156/413 (37%), Positives = 238/413 (57%), Gaps = 16/413 (3%) Query: 26 KSIFSGSVGNMVEWYDWYVYAAFSLYFAKAFFPKGDTTAQLLNTAAIFAVGFLMRPIGGW 85 +++ + +GN VEWYDW VYA F+ + A A F D T+ +L T AIFAVGFL RP+GG Sbjct: 20 RTLVATGIGNAVEWYDWAVYATFAPFLAGALFNPADKTSAVLATLAIFAVGFLARPMGGL 79 Query: 86 LMGLYADRAGRKAALMASVYLMCFGSLIIALSPGYETIGVGAPILLVFARLLQGLSVGGE 145 + GL DR GRK+ + ++ L GSL+IA++PGY+++G A +L+ ARLLQGL+ GGE Sbjct: 80 VFGLLGDRIGRKSTMTLAITLASLGSLLIAVAPGYDSVGAVASAILLAARLLQGLAHGGE 139 Query: 146 YGTSATYLSEMATKERRGFFSSFQYVTLISGQLIALGVLIVLQQTLTTEQLYDWGWRIPF 205 S TYL+EMA KE+RG +S+ + + +G L + V+ TLT + WGWR+PF Sbjct: 140 MPASQTYLAEMAPKEKRGLWSTLIFTSGTAGVLFGTLLGAVMTATLTRADMQAWGWRVPF 199 Query: 206 AIGALCAIVALYLRRGMEETESFAKKEKSKESA--MRTLLRHPKELMTVVGLTMGGTLAF 263 IGA+ + AL++R ++E+E F+K ++ + A ++R+ K+ + V+GLT+G TLA+ Sbjct: 200 IIGAVLGLYALFMRSMLDESEVFSKVDQKTKRAPIWPQIVRNRKQALQVIGLTVGLTLAY 259 Query: 264 YTYTTYMQKYLVNTVGMSISDSTTISAATLFLFMCLQPIIGGLSDKVGRRPILIAFGILG 323 Y + + + +GM ++ +F+ G LSD++GR+ +L G +G Sbjct: 260 YVWGVGATSHAITKLGMDAGEALRAGLVGNIVFIIALFFWGKLSDRIGRKKVLFT-GAVG 318 Query: 324 TLFTVPILTTLHTIQTW------WGAFFLIMAALIIVSGYTSINAVVKAELFPTEIRALG 377 LH TW W + LI V+ SI V AELFPT IR +G Sbjct: 319 A-------AVLHFPMTWLLKDQPWQLVVTMSVMLIFVAANASILPAVYAELFPTTIRTVG 371 Query: 378 VGLPYALTVSIFGGTAEYIALWFKSIGMETGYYWYVTACIAVSLLVYVTMKDT 430 + +PYA+ V+IFGGTA Y+ W S+ + + Y A + S + T+ +T Sbjct: 372 MAVPYAVCVAIFGGTAPYLQAWLGSLNLAIAFNMYAVAMLLTSAVFAFTIPET 424 Lambda K H 0.325 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 592 Number of extensions: 40 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 434 Length adjustment: 32 Effective length of query: 407 Effective length of database: 402 Effective search space: 163614 Effective search space used: 163614 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory