Align NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate WP_058929223.1 AU252_RS01555 carnitine dehydratase
Query= metacyc::MONOMER-16244 (495 letters) >NCBI__GCF_001484605.1:WP_058929223.1 Length = 508 Score = 386 bits (991), Expect = e-111 Identities = 207/478 (43%), Positives = 289/478 (60%), Gaps = 8/478 (1%) Query: 23 LFINNEFVQSKSKKTFGTVSPSTEEEITQVYEAFSEDIDDAVEAATAAF-HSSWSTSDPQ 81 + I+ +VQS S +TF V P +V A ED+D AV AA AF W + P Sbjct: 23 MLIDGAWVQSSSGETFACVDPYDNASWGRVPAATVEDVDRAVRAARRAFDEGGWPQTLPS 82 Query: 82 VRMKVLYKLADLIDEHADTLAHIEALDNGKSLMCSKGDVALTAAYFRSCAGWTDKIKGSV 141 R +L + ADL+ E+AD LA + +NGK + + AG + I+G Sbjct: 83 QRAALLRRFADLLTENADELARGQIHENGKLIGEMTWGALQMGQHAHYVAGLAETIQGRT 142 Query: 142 IETG-DTHFNYTRREPIGVCGQIIPWNFPLLMASWKLGPVLCTGCTTVLKTAESTPLSAL 200 IE+ +T REPIGV I PWN PL++ SWKL L G T V+K +E+TP S L Sbjct: 143 IESNWPNTAAFTFREPIGVVAMITPWNSPLMLLSWKLFAALAAGNTVVIKPSEATPTSTL 202 Query: 201 YLASLIKEAGAPPGVVNVVSGFGPTAGAPISSHPKIKKVAFTGSTATGRHIMKAAAESNL 260 +A L EAG PPGV+NVV+GFG G+ + H + K+AFTGST+ GR I K AAE Sbjct: 203 RMAELAMEAGFPPGVINVVTGFGQPTGSALVDHRGVDKIAFTGSTSAGRAINKQAAE-RF 261 Query: 261 KKVTLELGGKSPNIVFDDADVKSTIQHLVTGIFYNTGEVCCAGSRIYVQEGIYDKIVSEF 320 +VTLELGGKSPNI+F DAD+ + + + GIF TG+ C GSR+ VQ+ IYD V Sbjct: 262 ARVTLELGGKSPNIIFSDADIDNAVHGAMAGIFGATGQTCMGGSRVLVQDSIYDDFVDRM 321 Query: 321 KNAAESLKIGDPFKEDTFMGAQTSQLQLDKILKYIDIGKKEGATVITGGERFG-----NK 375 A ++L +GDP MG +++ Q K++ Y+D+G+ EGA V+ GG R +K Sbjct: 322 ARATQALTLGDPLDPTVDMGPVSNRAQFQKVIDYVDLGQSEGAEVVAGGARCMTTSELSK 381 Query: 376 GYFIKPTIFGDVKEDHQIVRDEIFGPVVTITKFKTVEEVIALANDSEYGLAAGVHTTNLS 435 G F +PT+F +V + ++ ++EIFGPV +I +F+ +E + +AN S++GLAAGV T ++S Sbjct: 382 GLFFEPTVFANVSNESRLAQEEIFGPVASIIRFRDEDEAVKIANASDFGLAAGVWTNDVS 441 Query: 436 TAISVSNKINSGTIWVNTYNDFHPMVPFGGYSQSGIGREMGEEALDNYTQVKAVRIGL 493 A + ++ SGT+WVNTY + VPFGG+ QSGIGRE+G +ALD YT+VK+ I L Sbjct: 442 RAHRMIRRVRSGTVWVNTYRLTNYSVPFGGFKQSGIGRELGPDALDAYTEVKSAWIDL 499 Lambda K H 0.316 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 655 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 508 Length adjustment: 34 Effective length of query: 461 Effective length of database: 474 Effective search space: 218514 Effective search space used: 218514 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory