Align acetyl-CoA:acetoacetate CoA transferase, A subunit (EC 2.8.3.8) (characterized)
to candidate WP_058930706.1 AU252_RS10770 3-oxoadipate CoA-transferase
Query= reanno::psRCH2:GFF1045 (231 letters) >NCBI__GCF_001484605.1:WP_058930706.1 Length = 219 Score = 207 bits (527), Expect = 1e-58 Identities = 109/211 (51%), Positives = 145/211 (68%), Gaps = 3/211 (1%) Query: 7 SAAHALEGLVEDGMTIAVGGFGLCGIPEQLIAALRDSGKKDLTAISNNAGVDGFGLGLLL 66 S A+ G ++DG T+ +GGFG G P +LI AL D G KDLT ++NNAG GL LL+ Sbjct: 7 SVNEAVSG-IKDGSTVMIGGFGNAGQPFELIDALMDCGAKDLTVVNNNAGQGDQGLALLI 65 Query: 67 ETRQISKMVSSYVGENKE--FERQYLAGELALEFTPQGTLAEKLRAGGAGIPAFYTKTGY 124 + ++ KM+ S+ ++ F+ +Y AGE+ LE PQG LAE++RA GAGI F+T TGY Sbjct: 66 KEGRVKKMICSFPRQSDSWHFDAKYHAGEIELELVPQGNLAERIRAAGAGIGGFFTPTGY 125 Query: 125 GTLVAEGKETRQFNGEWYVMEESLTADLALVKAWKADKAGNLLFRKTARNFNPLAAMAGE 184 GT++AEGKETR +G V E + AD+AL+KA KAD GNL++RKTARNF P+ A A + Sbjct: 126 GTMLAEGKETRIIDGRGQVFETPIHADVALIKALKADGVGNLVYRKTARNFGPIMAAAAK 185 Query: 185 VCVVEVEEIVETGELDPDQIHLPGIYVHRIV 215 VV+V EIV TG LDP+ I PGI+V+ IV Sbjct: 186 HTVVQVSEIVPTGGLDPENIVTPGIFVNSIV 216 Lambda K H 0.316 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 231 Length of database: 219 Length adjustment: 22 Effective length of query: 209 Effective length of database: 197 Effective search space: 41173 Effective search space used: 41173 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory