Align Alpha-ketoglutarate permease, MFS superfamily (characterized)
to candidate WP_058931242.1 AU252_RS13955 MFS transporter
Query= reanno::pseudo3_N2E3:AO353_03810 (439 letters) >NCBI__GCF_001484605.1:WP_058931242.1 Length = 430 Score = 307 bits (787), Expect = 4e-88 Identities = 164/423 (38%), Positives = 243/423 (57%), Gaps = 4/423 (0%) Query: 11 SAAVPAKEKTTASRIKSIFSGSVGNMVEWYDWYVYAAFSLYFAKAFFPKGDTTAQLLNTA 70 +A VPA + S ++++ +GN VEWYDW +YA FS + A A F K D T+ L T Sbjct: 4 TAGVPADVQVHKSHLRTLVGTGIGNAVEWYDWAIYATFSPFIASALFSKADPTSAFLATL 63 Query: 71 AIFAVGFLMRPIGGWLMGLYADRAGRKAALMASVYLMCFGSLIIALSPGYETIGVGAPIL 130 AIFAVGF+ RP GG++ G DR GRK ++ +V L GSLII ++P +E +G A +L Sbjct: 64 AIFAVGFVARPFGGFVFGWIGDRIGRKTSMTFAVGLAALGSLIIGVAPTFEAVGAFASVL 123 Query: 131 LVFARLLQGLSVGGEYGTSATYLSEMATKERRGFFSSFQYVTLISGQLIALGVLIVLQQT 190 L+ ARL+QGL+ GGE +S TYLSEMA KE RGF+++ Y + G L + +L Sbjct: 124 LLVARLIQGLAHGGELPSSQTYLSEMAPKEHRGFWATLIYTSGTVGILAGTMLGAILSNV 183 Query: 191 LTTEQLYDWGWRIPFAIGALCAIVALYLRRGMEETESF-AKKEKSKESAM-RTLLRHPKE 248 L+T + WGWR+PF IG + AL++R M+ET +F A+ K K M + +H K+ Sbjct: 184 LSTADMNAWGWRVPFLIGGAMGLYALFMRARMKETAAFEAESPKEKHEPMWPQIYQHRKQ 243 Query: 249 LMTVVGLTMGGTLAFYTYTTYMQKYLVNTVGMSISDSTTISAATLFLFMCLQPIIGGLSD 308 + V+GLT+G T+ +Y + Y + + M ++ S LF+ P G LSD Sbjct: 244 ALQVIGLTVGLTVTYYIWGVVTPSYAASVLKMDRGEALWASVIANVLFIAALPFWGKLSD 303 Query: 309 KVGRRPILIAFGILGTLFTVPILTTLHTIQTWWGAFFLIMAALIIVSGYTSINAVVKAEL 368 ++GRRP++I LF P+ L + W + L ++G +I V AEL Sbjct: 304 RIGRRPVMIMSAAGAALFHFPMTWLLK--DSPWQLAVTMSVMLFFIAGSAAIVPAVYAEL 361 Query: 369 FPTEIRALGVGLPYALTVSIFGGTAEYIALWFKSIGMETGYYWYVTACIAVSLLVYVTMK 428 FPT+IR +GVG+PY++ V++FGGTA Y+ W SIG + Y +A+S+ T+ Sbjct: 362 FPTKIRTVGVGVPYSICVAVFGGTAPYLQAWLGSIGQGNLFNVYAVVLLAISIAFVFTIP 421 Query: 429 DTR 431 +T+ Sbjct: 422 ETK 424 Lambda K H 0.325 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 614 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 430 Length adjustment: 32 Effective length of query: 407 Effective length of database: 398 Effective search space: 161986 Effective search space used: 161986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory