Align Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 (characterized)
to candidate WP_058931712.1 AU252_RS16800 acetyl-CoA C-acetyltransferase
Query= SwissProt::P14611 (393 letters) >NCBI__GCF_001484605.1:WP_058931712.1 Length = 399 Score = 347 bits (890), Expect = e-100 Identities = 189/391 (48%), Positives = 249/391 (63%) Query: 2 TDVVIVSAARTAVGKFGGSLAKIPAPELGAVVIKAALERAGVKPEQVSEVIMGQVLTAGS 61 TDVVI++ ART G+ G LA A ELGA I++A+ +GV QV VIMGQVL AG+ Sbjct: 8 TDVVILAGARTPQGRLNGQLASFTAVELGAHAIRSAIAASGVDAGQVDAVIMGQVLQAGA 67 Query: 62 GQNPARQAAIKAGLPAMVPAMTINKVCGSGLKAVMLAANAIMAGDAEIVVAGGQENMSAA 121 GQNPARQ+AI AG+ VP +TINKVC SGL AV+ AA I +GDA +VVAGGQE+M+ A Sbjct: 68 GQNPARQSAIGAGIGWNVPTVTINKVCLSGLTAVIDAARMIRSGDATVVVAGGQESMTRA 127 Query: 122 PHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGITAENVAKEYGITREAQDEFAVG 181 PH+LPGSR G+ G + +D DGL D ++ MG++ E GI R +QD A Sbjct: 128 PHLLPGSRQGWTYGAIQALDVAAHDGLTDAFDGQSMGLSTETKNLTLGIDRTSQDNVAAH 187 Query: 182 SQNKAEAAQKAGKFDEEIVPVLIPQRKGDPVAFKTDEFVRQGATLDSMSGLKPAFDKAGT 241 S +A A K G FD+EI P+ + QRKGDP+ TDE VR +++S++GL+ AF GT Sbjct: 188 SHQRAALAAKNGVFDDEIAPISVKQRKGDPIVVSTDEGVRPNTSIESLAGLRAAFVSDGT 247 Query: 242 VTAANASGLNDGAAAVVVMSAAKAKELGLTPLATIKSYANAGVDPKVMGMGPVPASKRAL 301 +TA N+S L+DGA+A+V+ S A+E GL LA + + P A AL Sbjct: 248 ITAGNSSPLSDGASALVLASRRFAEENGLEYLAVVGKPGQVAGPDNSLHSQPSHAIMNAL 307 Query: 302 SRAEWTPQDLDLMEINEAFAAQALAVHQQMGWDTSKVNVNGGAIAIGHPIGASGCRILVT 361 RAEW+ DLD +EINEAF + A+ + + + K N++GGAIA+GHPIGASG R+ + Sbjct: 308 QRAEWSTADLDFIEINEAFGSVAVQSLKDLDYPLDKCNIHGGAIALGHPIGASGARLALH 367 Query: 362 LLHEMKRRDAKKGLASLCIGGGMGVALAVER 392 HE+KRR + K SLC GGG G AL + R Sbjct: 368 AAHELKRRGSGKAAVSLCGGGGQGEALLLYR 398 Lambda K H 0.315 0.131 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 415 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 399 Length adjustment: 31 Effective length of query: 362 Effective length of database: 368 Effective search space: 133216 Effective search space used: 133216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory