Align Galactokinase; EC 2.7.1.6; Galactose kinase (uncharacterized)
to candidate WP_058932741.1 AU252_RS04315 galactokinase
Query= curated2:P13227 (397 letters) >NCBI__GCF_001484605.1:WP_058932741.1 Length = 387 Score = 308 bits (788), Expect = 2e-88 Identities = 179/366 (48%), Positives = 221/366 (60%), Gaps = 4/366 (1%) Query: 18 GRSRRGCGRRAGRENLIGEHTDYNDGFVMPSALPHQV-AAVSRRERRILRLHSADVDADP 76 GR G + GR NLIGEHTDYN+GFV+P A+ AV R +RL S D Sbjct: 20 GRLPDGVWQAPGRVNLIGEHTDYNEGFVLPFAIDKTARVAVGVRPDSTVRLLSTYGDHGM 79 Query: 77 VELRVADLAPASDKSWTAYPSGVLWALREAGHELTGADVHLASTVPSGAGLSSSAALEVR 136 V + L AS K WT YP GV+WAL++ G + G D+ L S VP GAGLSSS A+E Sbjct: 80 VTADLGSLDAASAKGWTKYPLGVMWALQQQGIAVPGVDLLLDSNVPLGAGLSSSHAIECA 139 Query: 137 PL-AMNDLYALALRGWQLARLCQRAENVYVGAPVGIMDQTASACCRGGHALFLDTRDLSQ 195 + A+NDL L ++ QRAEN +VGAP GIMDQ+AS GHA+FLD RD S Sbjct: 140 VISALNDLTGAGLEPEEMVLATQRAENDFVGAPTGIMDQSASLRGSKGHAVFLDCRDQSV 199 Query: 196 RQIPFDLAAEGMRLLVVDTRVKHSHSEGEYGKRRAGCEKGAALLGVDALCDVPYADLDAA 255 + +PF+ G+ +LV+DT V HSH++G Y RRA CE GA +LGV AL DV DL+ A Sbjct: 200 QLVPFETEPAGLVMLVIDTNVSHSHADGGYASRRASCELGAEVLGVKALRDVRMEDLEEA 259 Query: 256 LERLGDEEEVRRLVRHVVTEDERVERVVALLESGDTRRIGAVLVEGHASLRDDFRISCPE 315 L +E R VRH+VTE++RV + V LL S IGA+L H S+RDDF ISCPE Sbjct: 260 AGLL--DEVTYRRVRHIVTENDRVLQTVELLASAGPGSIGALLDASHVSMRDDFEISCPE 317 Query: 316 LDLVVDTALASAALGRRMTGGGFGGSAIVLVEAAAVDAVTKAVEDAFAAAGLKRPRVFEA 375 LDL V T+ A+ A+G RMTGGGFGG+AI L + V AV AF AG P +F Sbjct: 318 LDLAVATSRANGAIGARMTGGGFGGAAIALTPVTSEQQVRAAVVRAFEEAGYTAPDIFTV 377 Query: 376 VPRRGA 381 P GA Sbjct: 378 TPAAGA 383 Lambda K H 0.319 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 387 Length adjustment: 31 Effective length of query: 366 Effective length of database: 356 Effective search space: 130296 Effective search space used: 130296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_058932741.1 AU252_RS04315 (galactokinase)
to HMM TIGR00131 (galK: galactokinase (EC 2.7.1.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00131.hmm # target sequence database: /tmp/gapView.26734.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00131 [M=388] Accession: TIGR00131 Description: gal_kin: galactokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-97 311.7 0.0 4.2e-97 311.4 0.0 1.0 1 lcl|NCBI__GCF_001484605.1:WP_058932741.1 AU252_RS04315 galactokinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001484605.1:WP_058932741.1 AU252_RS04315 galactokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 311.4 0.0 4.2e-97 4.2e-97 4 370 .. 11 368 .. 8 385 .. 0.92 Alignments for each domain: == domain 1 score: 311.4 bits; conditional E-value: 4.2e-97 TIGR00131 4 vkkiFasaykekpdlvvraPGRvnliGehiDYndgsvlPlaidvdtlvavkerddknvsitlanadnkl 72 + F + ++ pd v +aPGRvnliGeh+DYn+g+vlP aid vav +r d +v++ ++ d + lcl|NCBI__GCF_001484605.1:WP_058932741.1 11 LAARFEQEFGRLPDGVWQAPGRVNLIGEHTDYNEGFVLPFAIDKTARVAVGVRPDSTVRLLSTYGDHGM 79 56789**************************************************************** PP TIGR00131 73 aerkldlpldksevsdWanYvkgvlkvlqeRfnsvplGldivisgdvPtgaGLsssaalevavaavlkn 141 l +s + W+ Y+ gv+ lq+ +vp G+d++++++vP gaGLsss a+e+av l++ lcl|NCBI__GCF_001484605.1:WP_058932741.1 80 VTADLGSLDAASA-KGWTKYPLGVMWALQQQGIAVP-GVDLLLDSNVPLGAGLSSSHAIECAVISALND 146 9999987666666.9*********************.******************************** PP TIGR00131 142 lgkleldskeillriqkveehfvGvncGgmDqlasvlGeedhallvefr..kLkatpvklpqleialvi 208 l l+ +e++l +q++e+ fvG+ +G+mDq as G + ha+++++r +++ p++ + ++ +++ lcl|NCBI__GCF_001484605.1:WP_058932741.1 147 LTGAGLEPEEMVLATQRAENDFVGAPTGIMDQSASLRGSKGHAVFLDCRdqSVQLVPFETEPAGLVMLV 215 *************************************************54455555555556****** PP TIGR00131 209 antnvksnlapseYnlRrqeveeaakvlakksekgaLrDvkeeefaryearltkllqlvekqRakhvvs 277 ++tnv + a++ Y Rr +e +a+vl +k aLrDv e+ + + + ll +v +R++h+v+ lcl|NCBI__GCF_001484605.1:WP_058932741.1 216 IDTNVSHSHADGGYASRRASCELGAEVLGVK----ALRDVRMEDLE---E-AAGLLDEVTYRRVRHIVT 276 *******************************....*********99...5.55555566666******* PP TIGR00131 278 enlRvlkavkllkdedlkelGkLmnesqasldddyeitvpeidelvesialvnGsiGsRltGaGfGGCt 346 en Rvl++v+ll ++G+L+++s+ s++dd+ei++pe+d l ++ +nG iG+R+tG+GfGG lcl|NCBI__GCF_001484605.1:WP_058932741.1 277 ENDRVLQTVELLASAGPGSIGALLDASHVSMRDDFEISCPELD-LAVATSRANGAIGARMTGGGFGGAA 344 *******************************************.8888899****************** PP TIGR00131 347 valvpnenvekvrkalaekYekkt 370 +al p ++vr a++ +e+ lcl|NCBI__GCF_001484605.1:WP_058932741.1 345 IALTPVTSEQQVRAAVVRAFEEAG 368 *****99999*****999988764 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (388 nodes) Target sequences: 1 (387 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.00 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory