Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate WP_066918726.1 ACG33_RS03505 acetyl-CoA C-acyltransferase
Query= metacyc::MONOMER-15952 (401 letters) >NCBI__GCF_001579945.1:WP_066918726.1 Length = 403 Score = 291 bits (745), Expect = 2e-83 Identities = 176/401 (43%), Positives = 238/401 (59%), Gaps = 5/401 (1%) Query: 1 MNEALIIDAVRTPIGRYAGALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYGCANQA 60 M A I+ VRT +G + G+L V ++L A ++A++AR LD + +DDV+ + A Sbjct: 1 MRRAAIVSPVRTGVGTFGGSLRPVPVEELAASVIRAVLAR-TGLDPARIDDVVMA-QSYA 58 Query: 61 GEDNRNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESM 120 + + R AAL AGLP+ VPG L+R CG GL AV +AA ++ G A ++L GGVESM Sbjct: 59 NSETPCIGRWAALQAGLPIEVPGMQLDRRCGGGLQAVIAAAMMVQTGAADVVLVGGVESM 118 Query: 121 SRAPFVMGKSEQ-AFGRSAEIFDTTIGWRFVNKLMQQGFGIDSMPETAENVAAQFNISRA 179 S + A S ++ D R ++ +++ I M ETAEN+A + ISR Sbjct: 119 SNIEYYTTDMRWGARAGSVKLHDRLDRGRERSQPVERFGPISGMIETAENLAREHGISRE 178 Query: 180 DQDAFALRSQHKAAAAIANGRLAKEIVAVEIAQRKGPAKIVEHDEHPRGDTTLEQLAKLG 239 + DA+A RS H+A A A GR E++ V + Q+KG DE R DT+ E LA L Sbjct: 179 EADAYAARSHHRARDAWAAGRFDAEVIPVSVPQKKGATLAFARDEGIRPDTSRESLAAL- 237 Query: 240 TPFRQGGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATAGVEPRIMGIGP 299 P +GG+VTAGN+S ND A A L+ + E L+ ++ A AG +P MG GP Sbjct: 238 RPLIKGGTVTAGNSSQQNDAAAACLVVAEEKLSSLRLEPMGFLIDWAAAGCDPATMGYGP 297 Query: 300 VPATRKVLELTGLALADMDVIELNEAFAAQGLAVLRELGLADDDERVNPNGGAIALGHPL 359 VPA K+L TGL+L MD++ELNEAFA Q LAVL+ G D D R+N NG I+LGHP+ Sbjct: 298 VPAVAKLLRRTGLSLDHMDLVELNEAFACQVLAVLKGWGWNDPD-RLNVNGSGISLGHPI 356 Query: 360 GMSGARLVTTALHELEERQGRYALCTMCIGVGQGIALIIER 400 G +G R++ T LHEL R GRY L TMCIG GQG+A I ER Sbjct: 357 GATGVRILATLLHELARRGGRYGLETMCIGGGQGLAAIFER 397 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 403 Length adjustment: 31 Effective length of query: 370 Effective length of database: 372 Effective search space: 137640 Effective search space used: 137640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory