Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_066920863.1 ACG33_RS10030 UDP-glucose 4-epimerase GalE
Query= curated2:Q59083 (348 letters) >NCBI__GCF_001579945.1:WP_066920863.1 Length = 331 Score = 362 bits (929), Expect = e-105 Identities = 184/321 (57%), Positives = 226/321 (70%), Gaps = 1/321 (0%) Query: 11 VLVTGGAGYIGSHVLHALTDAGIPAVTIDDLSAGRREAIPAAVPLVEGDIGSAELLDRVM 70 +L+TGGAGYIGSHV L + V +D+LS G R A+ L+ GD G EL+ RV+ Sbjct: 3 ILITGGAGYIGSHVARQLGERQEKIVILDNLSTGFRSAVLHG-ELIVGDTGDRELVARVL 61 Query: 71 RDHRVDAVMHFAGSIVVPESVVKPLDYYRNNTANSLTLLGACLRAGIDKVVFSSTAAVYG 130 R+H +D VMHFA +VPESV PL YY NNT ++ LL +AG+ VFSSTAAVYG Sbjct: 62 REHDIDTVMHFAAHTIVPESVSDPLKYYGNNTCSTRNLLQCSQQAGVQHFVFSSTAAVYG 121 Query: 131 APESVPIREDAPTVPINPYGASKLMTEQMLRDAGAAHGLRSVILRYFNVAGADPAGRTGQ 190 PE ED+PT PINPYG SKLM+E MLRD AA LR V+LRYFNVAG+DP GR GQ Sbjct: 122 IPEGGIAAEDSPTQPINPYGTSKLMSEWMLRDLAAASTLRHVVLRYFNVAGSDPGGRIGQ 181 Query: 191 ATPVATHLIKVACQALLGRRPPLAIFGTDYDTPDGTCIRDYIHVSDLADAHVLALLHLRR 250 +T AT L KVAC+A +G+R ++IFGTDYDTPDGT +RDYIHV DLA AHV AL +LR Sbjct: 182 STLKATLLTKVACEAAVGKRAHISIFGTDYDTPDGTGVRDYIHVEDLAAAHVKALDYLRA 241 Query: 251 GGGSLLMNCGYGRGASVREVVRTLEEVSGEQVPATFADRRPGDPPQLVAGADRIREQLGW 310 GG + +NCGYG G SVRE++ T++ ++G + RR GDPP L+A A R+RE LGW Sbjct: 242 GGAPVTLNCGYGHGYSVRELIATVDRLNGTPLKTLEEPRRAGDPPTLIARAQRVREVLGW 301 Query: 311 VPKHDRLDGIVRSALSWERSL 331 +P+HD LD IVRS L+WER L Sbjct: 302 IPRHDDLDTIVRSQLAWERRL 322 Lambda K H 0.319 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 331 Length adjustment: 28 Effective length of query: 320 Effective length of database: 303 Effective search space: 96960 Effective search space used: 96960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_066920863.1 ACG33_RS10030 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.20768.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-132 427.9 0.0 1.2e-132 427.7 0.0 1.0 1 lcl|NCBI__GCF_001579945.1:WP_066920863.1 ACG33_RS10030 UDP-glucose 4-epim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001579945.1:WP_066920863.1 ACG33_RS10030 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 427.7 0.0 1.2e-132 1.2e-132 2 328 .. 3 322 .. 2 326 .. 0.99 Alignments for each domain: == domain 1 score: 427.7 bits; conditional E-value: 1.2e-132 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekitevklvegdladkekleavleeek 70 iL+tGgaGyiGshv+rql e++ ++v+lDnls+g+++a+ ++e l+ gd d+e +++vl+e++ lcl|NCBI__GCF_001579945.1:WP_066920863.1 3 ILITGGAGYIGSHVARQLGERQEKIVILDNLSTGFRSAVLHGE------LIVGDTGDRELVARVLREHD 65 9******************************************......******************** PP TIGR01179 71 idaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEespl 139 id+v+Hfaa + v+Esv++PlkYY nn+ +t +Ll++ q+agv++++Fss+aavYg +e E+sp+ lcl|NCBI__GCF_001579945.1:WP_066920863.1 66 IDTVMHFAAHTIVPESVSDPLKYYGNNTCSTRNLLQCSQQAGVQHFVFSSTAAVYGIPEGGIAAEDSPT 134 ********************************************************************* PP TIGR01179 140 npinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathliklvaevavgkre 208 +pinpYG+sklm+E++l+dl+ a + l++v+LRYFnvaG d+ g+iG+++ +at l k+++e+avgkr lcl|NCBI__GCF_001579945.1:WP_066920863.1 135 QPINPYGTSKLMSEWMLRDLAAA-STLRHVVLRYFNVAGSDPGGRIGQSTLKATLLTKVACEAAVGKRA 202 ********************999.********************************************* PP TIGR01179 209 kleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsgk 277 +++ifGtdy+t+DGt+vRDyiHveDla+aH++al++l +gg ++n+G+g+g+sv+e+i +v+++ g+ lcl|NCBI__GCF_001579945.1:WP_066920863.1 203 HISIFGTDYDTPDGTGVRDYIHVEDLAAAHVKALDYLRAGGAPVTLNCGYGHGYSVRELIATVDRLNGT 271 ********************************************************************* PP TIGR01179 278 dikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekkl 328 ++k+ +++rRaGDp++l+a a++++++lgw p++ddL++i++s ++We++l lcl|NCBI__GCF_001579945.1:WP_066920863.1 272 PLKTLEEPRRAGDPPTLIARAQRVREVLGWIPRHDDLDTIVRSQLAWERRL 322 ************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (331 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.33 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory