Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_068167498.1 HTA01S_RS05100 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_001592305.1:WP_068167498.1 Length = 270 Score = 209 bits (531), Expect = 6e-59 Identities = 115/241 (47%), Positives = 156/241 (64%), Gaps = 7/241 (2%) Query: 8 VLLQVKGLKVAYGGIQAV-KGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLS-----M 61 ++L V G++V Y + V KGV V EG++ +++G NGAGKTTT++AI+ L + Sbjct: 7 IVLNVNGIEVIYNHVILVLKGVSLNVPEGKIAAVLGGNGAGKTTTLRAISNLLKAERGEV 66 Query: 62 NDGNIEYLGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKDKAGILAD 121 G+IE G I+ DLV G+V V EGR FA +TI ENL G+Y R DK I A+ Sbjct: 67 TKGSIELRGDRIENLTPADLVNRGVVQVMEGRHCFAHLTIEENLLTGSYTRTDKGEIAAN 126 Query: 122 IEKMFTIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMVDKI 181 +EK++ FPRL+ R+ A SGGEQQM A+GRALM+ P V+LLDEPSMGL+P +V+++ Sbjct: 127 LEKVYNYFPRLKTRRTSQAAYTSGGEQQMCAIGRALMTNPSVMLLDEPSMGLAPQIVEEV 186 Query: 182 FEVVRDVYAL-GVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLNDPKVRAAYL 240 FE+V+D+ VT +L EQN + AL AD GY+MESG I M G L N+ V+ YL Sbjct: 187 FEIVKDLNTKEKVTFLLAEQNTNMALRYADYGYIMESGRIVMDGAAADLRNNEDVKEFYL 246 Query: 241 G 241 G Sbjct: 247 G 247 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 270 Length adjustment: 24 Effective length of query: 218 Effective length of database: 246 Effective search space: 53628 Effective search space used: 53628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory