Align RhaQ (characterized, see rationale)
to candidate WP_068167537.1 HTA01S_RS05335 ABC transporter permease
Query= uniprot:Q7BSH2 (337 letters) >NCBI__GCF_001592305.1:WP_068167537.1 Length = 333 Score = 138 bits (348), Expect = 2e-37 Identities = 92/311 (29%), Positives = 163/311 (52%), Gaps = 16/311 (5%) Query: 24 IAASWEVLLFAVAV-LIFVFNSLASPYFLDAWNLSDATFNFTEKAMIAFAMALLVISGEI 82 + A ++L FA + L+ VF+ L F+ N + T ++A A ++I+ I Sbjct: 17 VQAKQKLLAFASLIALLAVFSVLKPDAFMTQDNFIGILQSTTVIGVLAIASTFVIITSGI 76 Query: 83 DLSVAAIIALASTAMGA-AVQIGIGTPGLVLIGIGTGLACGVFNGVLVSVLKLPSIVVTI 141 DLSV ++ + G V +G P + + G G +G++++ LK+P + T+ Sbjct: 77 DLSVGVLMTFCAVMAGVFIVNLGFPLPLGIACALAMGALSGCISGLVITKLKVPPFIATL 136 Query: 142 GTMSLFRGISYIVLGDQAYGKYPADFAYFGQGYVVWVFSFEF----------VLFIVLAV 191 G M L +G+S ++ Q Y +D F Q + + F +LF+V AV Sbjct: 137 GMMMLLKGLSLLIT--QTRPIYFSDVEGFDQISLGSLIGDVFPSLPIPNGVLILFLVAAV 194 Query: 192 LFAILLHATNFGRQVYAIGNNDFAARFSGIPVERVKSILFLLTGIMSGIAAVCLTSRLGS 251 A++L+ T GR +A+G+N+ A R SG+ V+R K I++ G + GI+ + + SRL S Sbjct: 195 C-AVVLNKTALGRYTFALGSNEEAVRLSGVNVDRWKVIIYTFAGGICGISGLLIASRLNS 253 Query: 252 TRPSIAQGWELEVVTMVVLGGISILGGFRHDRGVFVIAAFVMGLVTFGLGLLNLPGIVMS 311 +P++ QG+EL+ + VV+GG S+ GG G +I AF+M ++ GL ++++ Sbjct: 254 AQPALGQGYELDAIAAVVIGGTSLSGGVGTILGT-IIGAFIMSVLINGLRIMSVAQEWQM 312 Query: 312 IFIGLLIIVTI 322 + GL+II+ + Sbjct: 313 VLTGLIIILAV 323 Lambda K H 0.330 0.145 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 333 Length adjustment: 28 Effective length of query: 309 Effective length of database: 305 Effective search space: 94245 Effective search space used: 94245 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory