Align L-rhamnose mutarotase; Rhamnose 1-epimerase; Type-3 mutarotase; EC 5.1.3.32 (characterized)
to candidate WP_068170321.1 HTA01S_RS10195 L-rhamnose mutarotase
Query= SwissProt::Q7BSH1 (106 letters) >NCBI__GCF_001592305.1:WP_068170321.1 Length = 106 Score = 141 bits (356), Expect = 2e-39 Identities = 66/105 (62%), Positives = 75/105 (71%) Query: 1 MTLEKHAFKMQLNPGMEAEYRKRHDEIWPELVDLLHQSGASDYSIHLDRETNTLFGVLTR 60 M EKHAF+M LNPG AEY +RHD IWPELV LL +G DYSI+LD E LF VL R Sbjct: 1 MPTEKHAFRMFLNPGCVAEYHRRHDAIWPELVTLLKDAGIEDYSIYLDEEHLVLFAVLRR 60 Query: 61 PKDHTMASLPDHPVMKKWWAHMADIMATNPDNSPVQSDLVTLFHM 105 HTMASLP HPVM++WW HM+DIM +PD SPV DL LFH+ Sbjct: 61 RAGHTMASLPQHPVMQRWWQHMSDIMRCHPDGSPVAEDLPCLFHL 105 Lambda K H 0.319 0.132 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 72 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 106 Length of database: 106 Length adjustment: 11 Effective length of query: 95 Effective length of database: 95 Effective search space: 9025 Effective search space used: 9025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 40 (20.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory