Align RhaQ (characterized, see rationale)
to candidate WP_068170323.1 HTA01S_RS10200 ABC transporter permease
Query= uniprot:Q7BSH2 (337 letters) >NCBI__GCF_001592305.1:WP_068170323.1 Length = 329 Score = 293 bits (751), Expect = 3e-84 Identities = 156/312 (50%), Positives = 215/312 (68%), Gaps = 8/312 (2%) Query: 27 SWEVLLFAVAVLIFVFNSLASPYFLDAWNLSDATFNFTEKAMIAFAMALLVISGEIDLSV 86 +WE +L A+ VL+++ L F + L+D T+NF+EKA+IA AMALLVI GEIDLS+ Sbjct: 6 TWERILIALIVLVYLGFGLGIEGFFTPYALADTTYNFSEKALIALAMALLVIGGEIDLSI 65 Query: 87 AAIIALASTAMGAAVQIGIGTPGLVLIGIGTGLACGVFNGVLVSVLKLPSIVVTIGTMSL 146 AAI+ALAS AMG A+Q G G +VL + TG ACG NG LV+ KLPSIVVTIGT+SL Sbjct: 66 AAIMALASMAMGFAMQAGAGVGTMVLAALATGAACGALNGWLVTRWKLPSIVVTIGTLSL 125 Query: 147 FRGISYIVLGDQAYGKYPADFAYFGQGYV-------VWVFSFEFVLFIVLAVLFAILLHA 199 +RG++ +VLGDQA YP +G GY+ ++ EF + +V A+L + LHA Sbjct: 126 YRGLAQVVLGDQAITGYPETLVTWGNGYLGDLMGMPGFIVPIEFAVMLVAALLVGLFLHA 185 Query: 200 TNFGRQVYAIGNNDFAARFSGIPVERVKSILFLLTGIMSGIAAVCLTSRLGSTRPSIAQG 259 T GR++YAIG N ARFSGI V+R + LF+ G+M+ +AAV LT R+GSTRP++A G Sbjct: 186 TVHGRRIYAIGANPVTARFSGIAVDRYRLGLFIFAGVMAALAAVLLTGRIGSTRPNLAMG 245 Query: 260 WELEVVTMVVLGGISILGGFRHDRGVFVIAAFVMGLVTFGLGLLNLPGIVMSIFIGLLII 319 WEL+ VT+V+LGG+SI GG G ++AA ++G TF +G+LN+ GIV+S+ +G L+I Sbjct: 246 WELDAVTIVILGGVSIQGGRGSVVGT-LLAAVLLGSFTFAMGMLNVTGIVVSMVVGGLLI 304 Query: 320 VTIAIPIIARRI 331 V + +P RR+ Sbjct: 305 VAMVLPQYLRRL 316 Lambda K H 0.330 0.145 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 329 Length adjustment: 28 Effective length of query: 309 Effective length of database: 301 Effective search space: 93009 Effective search space used: 93009 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory