Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_068172853.1 HTA01S_RS14300 ABC transporter ATP-binding protein
Query= TCDB::Q8YT15 (247 letters) >NCBI__GCF_001592305.1:WP_068172853.1 Length = 244 Score = 224 bits (572), Expect = 9e-64 Identities = 116/240 (48%), Positives = 164/240 (68%), Gaps = 6/240 (2%) Query: 10 PLLEVENVHAGYIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGKI 69 P+L+V+ + AGY + ++L G++ + E G ++TVIGPNGAGKSTL T+ G+L P G I Sbjct: 4 PILQVKGLRAGYGR-AEVLHGIDIQAEPGSVITVIGPNGAGKSTLLNTLMGIL-PGKGLI 61 Query: 70 TFKGKNIAGLKSNQIVRLGMCYVPQIANVFPSLSVEENLEMGAF----IRNDSLQPLKDK 125 F+G++IA L + V GM VP+ +F ++ VE+NL +G F + N + D Sbjct: 62 EFRGQDIATLTLEERVMNGMSLVPEKRELFGTMPVEDNLLLGGFRQMRLGNAQWRSRLDD 121 Query: 126 IFAMFPRLSDRRRQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPILVTQVFEQ 185 ++A+FPRL +RR Q AGTLSGGERQMLA+G+ALM P LL+LDEPS L+P++V ++F Sbjct: 122 VYALFPRLQERRTQLAGTLSGGERQMLAVGRALMSRPDLLMLDEPSLGLAPLIVREIFSI 181 Query: 186 VKQINQEGTAIILVEQNARKALEMADRGYVLESGRDAISGPGQELLTDPKVAELYLGAGK 245 ++ + Q G I+LVEQNAR AL++AD GYVLE G + GP EL +DP+V E YLG + Sbjct: 182 IQTLRQTGVTIVLVEQNARAALQVADHGYVLEMGELSAQGPASELASDPRVIETYLGTAR 241 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 244 Length adjustment: 24 Effective length of query: 223 Effective length of database: 220 Effective search space: 49060 Effective search space used: 49060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory