Align LacK, component of Lactose porter (characterized)
to candidate WP_068174360.1 HTA01S_RS19170 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q01937 (363 letters) >NCBI__GCF_001592305.1:WP_068174360.1 Length = 337 Score = 298 bits (762), Expect = 2e-85 Identities = 172/340 (50%), Positives = 218/340 (64%), Gaps = 38/340 (11%) Query: 1 MAEVRLTDIRKSYGS----LEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDIS 56 MA + L ++ K Y + L+VI GVN E++ EF+V VGPSGCGKSTLLRM+AGLEDIS Sbjct: 1 MASISLRNVVKRYRTGKTELQVIHGVNAEIADREFIVIVGPSGCGKSTLLRMVAGLEDIS 60 Query: 57 SGELTIGGTVMNDVDPSKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNA 116 G++ IG V+N ++P++R IAMVFQ YALYPHMTV +NM + L+ + EI++RV+ Sbjct: 61 GGDICIGERVVNTLEPAERDIAMVFQNYALYPHMTVFDNMAYGLKIKKLPIAEIKQRVDK 120 Query: 117 AAKILELDALMDRKPKALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEI 176 AA ILEL L+ RKP+ LSGGQRQRVA+GRAIVRQP VFLFDEPLSNLDA+LR R+EI Sbjct: 121 AAGILELGHLLTRKPRELSGGQRQRVAMGRAIVRQPQVFLFDEPLSNLDAKLRAQTRLEI 180 Query: 177 ARLHKELNATIVYVTHDQVEAMTLADKIVVMRGGIVEQVGAPLALYDDPDNMFVAGFIGS 236 +LH+EL T ++VTHDQVEAMTLA +++VM G +EQ G P +Y P FVA FIGS Sbjct: 181 QKLHRELGITSLFVTHDQVEAMTLAQRMIVMNAGRMEQFGTPEEVYTRPATTFVASFIGS 240 Query: 237 PRMNFLPAVVIGQAEGGQVTVALKARPDTQLTVACATPPQGGDAVTVGVRPEHFLPAGSG 296 P MN L A GG RP + L G+RPEH G Sbjct: 241 PPMNLLQ-----HAPGG--------RPGSLL----------------GIRPEHI---DIG 268 Query: 297 DTQLTAHVDVVEHLGNTSYVYAHTVPGEQIIIEQEERRHG 336 D+ V+ VE LG V+A G++I+I + G Sbjct: 269 DSGWALQVETVELLGAERLVHARL--GDEILIIRTHEDQG 306 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 337 Length adjustment: 29 Effective length of query: 334 Effective length of database: 308 Effective search space: 102872 Effective search space used: 102872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory