Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate WP_068459110.1 APY04_RS01545 AMP-dependent synthetase
Query= reanno::acidovorax_3H11:Ac3H11_3009 (578 letters) >NCBI__GCF_001541235.1:WP_068459110.1 Length = 520 Score = 201 bits (512), Expect = 5e-56 Identities = 163/548 (29%), Positives = 255/548 (46%), Gaps = 47/548 (8%) Query: 33 AFFADMVARQPEREALVSVHQGRRYTYAQLQTEAHRLASALLGMGLTPGDRVGIWSHNNA 92 +F R P++ ALV+ + RR TY+QL + LA L+ G+ GDRV ++ N+ Sbjct: 5 SFLRASAMRFPDKTALVAGN--RRLTYSQLDDISDELAQGLIHRGIETGDRVVLFLDNSV 62 Query: 93 EWVLMQLATAQVGLVLVNINPAYRTAEVEYALNKVGCKLLVSMARFKTSDYLGMLRELAP 152 E V+ A + G V +NP+ +T ++ Y LN C+ +A+ KT+ Sbjct: 63 EAVVSIFAVLKAGGVFSPVNPSIKTDKLSYILNN--CRAKAIIAQQKTASVAADA----- 115 Query: 153 EWQGQQPGHLQAAKLPQLKTVVWIDDE---AGQGADEPGLLRFTELIARGNAADPRLAQV 209 A P + V D E AG GA L + +++A + L Q Sbjct: 116 -----------TAAAPSVAFSVIADGESVPAGFGA-----LHWNDVLA---VPEFSLLQS 156 Query: 210 AAGLQATDPINIQFTSGTTGFPKGATLTHRNILNNGFFIGECMKLTPADRLCIPVPLYHC 269 A G+ D + +TSG+TGFPKG +TH+N++ I ++ T D + +P+ Sbjct: 157 APGINV-DLAMLIYTSGSTGFPKGVMMTHQNVVAAATSITTYLENTADDIILNVLPVAFD 215 Query: 270 FGMVLGNLACFTHGATIVYPNDGFDPLTVLQTVQDERCTGLHGVPTMFIAELDHPRFAEF 329 +G+ +A GAT+V P +L+ ++ER TGL VPTM + A Sbjct: 216 YGLYQVLMAIKV-GATLVLEKSFAFPQVILKRCEEERVTGLPLVPTMAAILVGQRNLAPG 274 Query: 330 NLSTLRTGIMAGSPCPTEVMKRVVEQMNLREITIAYGMTETSPVSCQSSTDTP---LSKR 386 L LR + P ++++ + YG+TE C+ T P L R Sbjct: 275 ALPHLRYITNTAAALPPTHIEKLQALFPHAALYSMYGLTE-----CKRCTWLPPQELKNR 329 Query: 387 VSTVGQVQPHLEVKIVDPDTGAVVPIGQRGEFCTKGYSVMHGYWGDEAKTREAIDEGGW- 445 +S+VG P E +VD D V P GE +G VM GYW + T +A+ G + Sbjct: 330 ISSVGVAIPGTEAYVVDDDGRRVGP-DVVGELVIRGAHVMKGYWENPEATAKALRPGPYP 388 Query: 446 ----MHTGDLATMDAEGYVNIVGRIKDMVIRGGENIYPREIEEFLYRHPQVQDVQVVGVP 501 ++TGDL D+EG++ VGR D++ GE + P+E+E +Y P V +V V+GVP Sbjct: 389 WEHVLYTGDLFRTDSEGFLYFVGRKDDIIKSRGEKVPPKEVENVIYALPGVAEVAVIGVP 448 Query: 502 DQKYGEELCAWIIAKPGTQPTEDDIRAFCKGQIAHYKVPRYIRFVTSFPMTVTGKIQKFK 561 D G + A + +PGT D+ C + Y VP+ + F S P T +GKI + Sbjct: 449 DAVLGSAIKAVVALEPGTDIGAQDVIRHCARFLEDYMVPKLVEFRPSLPKTDSGKISRRL 508 Query: 562 IRDEMKDQ 569 + + + Q Sbjct: 509 VSEAERGQ 516 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 635 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 578 Length of database: 520 Length adjustment: 36 Effective length of query: 542 Effective length of database: 484 Effective search space: 262328 Effective search space used: 262328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory