Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_068460111.1 APY04_RS04140 LPS export ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_001541235.1:WP_068460111.1 Length = 276 Score = 118 bits (296), Expect = 1e-31 Identities = 76/249 (30%), Positives = 122/249 (48%), Gaps = 19/249 (7%) Query: 10 LKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFELA 69 L + + K + + V I ++RG+ GL+GPNGAGKTT F +ITGL D GT + Sbjct: 41 LTIREVRKSYKKRLVVRSVSIDVRRGESVGLLGPNGAGKTTVFYMITGLVPADNGTITID 100 Query: 70 GKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFKA 129 G ++ A+ GI Q +F ++ +N+M I Sbjct: 101 GLDVTRLPMYRRARLGIGYLPQEASIFRGLSVEKNIMAVLEI-----------------V 143 Query: 130 EEAAIAKRA--QELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAG 187 E +A +R + LL+ I + LS G++RR EIARALA+ P + LDEP AG Sbjct: 144 EPSAKKRREKLESLLEEFRITHLRKSPSIALSGGERRRCEIARALASGPSFMLLDEPFAG 203 Query: 188 MNATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKN 247 ++ ++EL+ + +L+ +H+V+ + L DR ++ G+ + +G P E+ N Sbjct: 204 IDPIAVGDIQELVRHLTERGIGVLITDHNVRETLSLIDRAYIIYDGQVLTQGKPEEIIAN 263 Query: 248 EKVIEAYLG 256 + V YLG Sbjct: 264 DDVRRVYLG 272 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 276 Length adjustment: 25 Effective length of query: 235 Effective length of database: 251 Effective search space: 58985 Effective search space used: 58985 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory