Align L-rhamnose-1-dehydrogenase; EC 1.1.1.173 (characterized)
to candidate WP_068461539.1 APY04_RS08205 NAD(P)-dependent oxidoreductase
Query= SwissProt::A3LZU7 (258 letters) >NCBI__GCF_001541235.1:WP_068461539.1 Length = 248 Score = 116 bits (291), Expect = 4e-31 Identities = 79/249 (31%), Positives = 124/249 (49%), Gaps = 14/249 (5%) Query: 8 KVVAITGGVTGIGRAIAIEMARNGAKVVVNHLPSEEQAQLAKELKEEISDGENNVLTIPG 67 KV ITG +GIGRAIA NG ++ + E ++ ++ E NV+ +PG Sbjct: 6 KVAVITGASSGIGRAIAERFLENGYRLALMARSEEGLLEIKRKSPE-------NVIVVPG 58 Query: 68 DISLPETGRRIVELAVEKFGEINVFVSNAGVCGFREFLEITPETLFQTVNINLNGAFFAI 127 D++ ++ R+VE +++ +G ++V + NAG F E P+ + + N+N A + Sbjct: 59 DVTKADSLDRLVEESIKAYGAVDVVIPNAGAAKVVPFTESGPDAIAEQFNLNFVAATETV 118 Query: 128 QAAAQQMVKQGKGGSIIGISSISALVGGAHQTHYTPTKAGILSLMQSTACALGKYGIRCN 187 + + Q GS+I I++ VG Y +KA + S Q+ A L GIR N Sbjct: 119 RKFLPHIAPQ---GSVIFITTFLTTVGFPGLAIYNSSKAALKSFAQTLAVELAPQGIRVN 175 Query: 188 AILPGTISTAL-NEEDLKDPEKRKYME---GRIPLGRVGDPKDIAGPAIFLASDMSNYVN 243 +I PG I T L + L E R+ GR G+P DIA A+FLAS + + Sbjct: 176 SIAPGPIGTPLWGKVGLPADVLASVAEAVNARLMPGRFGEPADIADTALFLASPGAKNIY 235 Query: 244 GAQLLVDGG 252 G +++VDGG Sbjct: 236 GQEIVVDGG 244 Lambda K H 0.317 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 248 Length adjustment: 24 Effective length of query: 234 Effective length of database: 224 Effective search space: 52416 Effective search space used: 52416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory