Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_072904983.1 BUB13_RS01530 UDP-glucose 4-epimerase GalE
Query= curated2:P55180 (339 letters) >NCBI__GCF_900142125.1:WP_072904983.1 Length = 338 Score = 412 bits (1058), Expect = e-120 Identities = 196/334 (58%), Positives = 252/334 (75%) Query: 3 ILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLLDR 62 +L+TGGAGYIGSHT +EL++SGY++V+ DN NSS L+R++EITG+ + D+ D Sbjct: 4 VLLTGGAGYIGSHTAIELISSGYQVVIADNFCNSSPVVLDRLEEITGQPIGCERGDIRDA 63 Query: 63 EAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIVFS 122 + + +FA ++AVIHFA LKAVGES PL+Y+ NN++GT L + M + +VFS Sbjct: 64 DFMSQLFATYRLDAVIHFAALKAVGESCEKPLEYFDNNISGTISLLQMMREADCNNLVFS 123 Query: 123 SSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNPFGA 182 SSATVYG P+ PITED L TNPYG+TKL++EQ++ D+ + +++ A+LRYFNP GA Sbjct: 124 SSATVYGDPDKCPITEDAALRVTNPYGRTKLVMEQLINDVCASHSDFKAAILRYFNPVGA 183 Query: 183 HPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLAEGH 242 H SG IGEDPN IPNNLMP+V+QVAVG+ EQL VFGNDYPT DGTGVRDYIHVVDLA H Sbjct: 184 HASGLIGEDPNDIPNNLMPFVSQVAVGRREQLQVFGNDYPTPDGTGVRDYIHVVDLARAH 243 Query: 243 VKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCFADP 302 V A++ +L NLGTG G SVLEMV+AFEK SGK+VPY+ A RR GDIA C+ADP Sbjct: 244 VAAVDYLLREQQNLTVNLGTGHGISVLEMVQAFEKASGKQVPYKIAPRRAGDIAECYADP 303 Query: 303 AKAKRELGWEAKRGLEEMCADSWRWQSSNVNGYK 336 A A + LGW+A+ G++EMC D+WRWQS N NG++ Sbjct: 304 ALANKLLGWQAEFGVDEMCVDAWRWQSQNPNGFE 337 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 418 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 338 Length adjustment: 28 Effective length of query: 311 Effective length of database: 310 Effective search space: 96410 Effective search space used: 96410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_072904983.1 BUB13_RS01530 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.19504.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-137 441.6 0.0 8.3e-137 441.4 0.0 1.0 1 lcl|NCBI__GCF_900142125.1:WP_072904983.1 BUB13_RS01530 UDP-glucose 4-epim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900142125.1:WP_072904983.1 BUB13_RS01530 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 441.4 0.0 8.3e-137 8.3e-137 2 331 .. 4 335 .. 3 336 .. 0.99 Alignments for each domain: == domain 1 score: 441.4 bits; conditional E-value: 8.3e-137 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavlee 68 +L+tGgaGyiGsh++ +l ++g++vv+ Dn +++s +l +le+it + +gd++d+ +++++++ lcl|NCBI__GCF_900142125.1:WP_072904983.1 4 VLLTGGAGYIGSHTAIELISSGYQVVIADNFCNSSPVVLDRLEEITgqPIGCERGDIRDADFMSQLFAT 72 8********************************************99889999**************** PP TIGR01179 69 ekidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEes 137 ++daviHfaal+avgEs ++Pl+Y++nn+++t++Ll++m++a +++l+Fsssa+vYg+++k pi+E++ lcl|NCBI__GCF_900142125.1:WP_072904983.1 73 YRLDAVIHFAALKAVGESCEKPLEYFDNNISGTISLLQMMREADCNNLVFSSSATVYGDPDKCPITEDA 141 ********************************************************************* PP TIGR01179 138 plnpinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknat.hliklvaevavg 205 +l ++npYGr+kl++E++++d+ +++++k +iLRYFn++GA+ +g iGe++++++ +l++ v +vavg lcl|NCBI__GCF_900142125.1:WP_072904983.1 142 ALRVTNPYGRTKLVMEQLINDVCASHSDFKAAILRYFNPVGAHASGLIGEDPNDIPnNLMPFVSQVAVG 210 ********************************************************9************ PP TIGR01179 206 krekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkv 274 +re+l++fG+dypt+DGt+vRDyiHv Dla aH+aa+++l ++++ + nlG+g+g sv+e+++a++k+ lcl|NCBI__GCF_900142125.1:WP_072904983.1 211 RREQLQVFGNDYPTPDGTGVRDYIHVVDLARAHVAAVDYLLREQQNLTVNLGTGHGISVLEMVQAFEKA 279 ********************************************************************* PP TIGR01179 275 sgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklkeg 331 sgk++++++a+rRaGD+a+++ad++ +++ lgw+++++ ++e++ +aw+W++++++g lcl|NCBI__GCF_900142125.1:WP_072904983.1 280 SGKQVPYKIAPRRAGDIAECYADPALANKLLGWQAEFG-VDEMCVDAWRWQSQNPNG 335 **************************************.**************9885 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (338 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.40 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory