Align Propionyl-CoA carboxylase carboxyl transferase subunit (EC 6.4.1.3) (characterized)
to candidate WP_072905258.1 BUB13_RS02685 acetyl-CoA carboxylase carboxyltransferase subunit
Query= reanno::PS:Dsui_0517 (510 letters) >NCBI__GCF_900142125.1:WP_072905258.1 Length = 574 Score = 299 bits (765), Expect = 2e-85 Identities = 189/540 (35%), Positives = 282/540 (52%), Gaps = 79/540 (14%) Query: 2 HDIIHELEKKREAARLGGGQKRIDSQHKKGKLTARERLELLLDPDS---FEEWDMFKEHR 58 HD+I E+ ++ +G +I+ QH K ++T ER+++L D D F+ W Sbjct: 43 HDLI---ERPIKSVAVG----QIEKQHFKQRMTVWERIKVLTDNDPNILFQNWG------ 89 Query: 59 CTDFGMAETKN-PGDGVVTGYGTINGRLVFVFSQDFTVFGGSLSETHAEKICKVMDHAMK 117 KN G +VTG I GR V ++ DFTV GS+ T+ K+ K+M A + Sbjct: 90 ---------KNLDGASLVTGILNIGGRDVALYGHDFTVRAGSIDATNGMKLAKIMQMAGE 140 Query: 118 VGAPVIGLNDSGGARIQEGVASLGGYADVFQRNVMASGVIPQISMIMGPCAGGAVYSPAM 177 G P+IG+NDS GA + GV L GYA+ F SGV+P + + G AGG Y P Sbjct: 141 KGIPLIGMNDSAGAFVPAGVGGLDGYAEAFTALRKISGVVPTVMCMFGFNAGGGSYLPRQ 200 Query: 178 TDFIFMVKDSSYMFVTGPEVVKTVTHEEVTAEELGGAVTHTTKSGVADLAFENDVEALNY 237 F+ +D+ + +TGP VVK+V E++T EELGG + H+ SGV DLA ++ AL Sbjct: 201 GSFVIQPEDT-FFGLTGPGVVKSVLGEDITPEELGGPLVHSA-SGVTDLAVADETAALRT 258 Query: 238 LRRLVNFLPANNREKPPVQKTNDPAERLDFSLDTLV------PDNANKPYDMKELIIKMV 291 RL+++LP NN P Q+T+DP +R + ++TL+ P N P+D+ +I ++ Sbjct: 259 AVRLLSYLPDNNYSMAPFQETSDPLDRKTWEINTLLKKAFNSPTGFNTPFDVSIIIQQIC 318 Query: 292 DDCDFFEIQPDYAKNIITGFARMDGHPVGIVANQPLVLAGCLDIKSSIKAARFVRFCDAF 351 D D+FE+QP A+ IT F R+ G+ VG VAN V +G +D S++K ARFVRFC+ + Sbjct: 319 DHGDYFEVQPTRAREAITAFGRLGGNVVGFVANNSAVASGQIDCDSAVKIARFVRFCNIY 378 Query: 352 NIPVVTLVDVPGFMPGTSQEYGGIIKHGAKLLYAYAECTVPKVTLITRKAYGGAYDVMSS 411 NIP++ + D GF+PG QE GI++ G +L + + P++ LI R AYGGAY ++ Sbjct: 379 NIPLIFMEDTTGFLPGREQEARGIVQAGRSMLDSIVDVRTPRILLILRNAYGGAYASYNN 438 Query: 412 KHLRGDVNLAWPSAEIAVMGPKGAVEIIFREE---------------------------- 443 D+ LA P+ +AVMGP G E +++ E Sbjct: 439 YPTGADLVLALPTTRLAVMGPAGK-EFVYKNELRGLRGSVKKKIAEAVQERTKAGMEGDA 497 Query: 444 -------------KNDPAKLAEREAEYKAKFANPFVAGARGFIDDVIMPNETRKRICRSL 490 KN+ A L R Y+ + NP A G I ++MP + RK + +L Sbjct: 498 ATKDAEKAVAEWLKNEEAALNTR---YEKELMNPKEGLALGSISSLVMPTDLRKVLGENL 554 Lambda K H 0.320 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 751 Number of extensions: 38 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 510 Length of database: 574 Length adjustment: 35 Effective length of query: 475 Effective length of database: 539 Effective search space: 256025 Effective search space used: 256025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory