Align NAD-dependent succinate semialdehyde dehydrogenase (EC 1.2.1.24) (characterized)
to candidate WP_073036359.1 BUB04_RS01755 NAD(P)-dependent oxidoreductase
Query= metacyc::MONOMER-15565 (287 letters) >NCBI__GCF_900129305.1:WP_073036359.1 Length = 290 Score = 209 bits (531), Expect = 8e-59 Identities = 106/284 (37%), Positives = 165/284 (58%) Query: 4 IGFLGIGIMGKAMAVNLLRHGFKVTVWNRTLSRCDELVQHGASVGETPAEVIKKCKYTIA 63 +GF+G+G MG MA N+ + G ++ V+NRT S+ + + G TPAE+ ++ I Sbjct: 3 VGFIGLGTMGSPMAQNIRKAGHELVVYNRTESKTEPFRRVGVPAAHTPAELARQSDVVII 62 Query: 64 MLSDPAAALSVVFDKHGALEHICAGKGYIDMSTVDADTSSQISQAITSKGGSFLEAPVSG 123 M++ P L V+ D+ G LE + G I+MSTV + + + + S GG FL+APVSG Sbjct: 63 MVTGPKELLGVLQDQQGLLEGLKPGTVVINMSTVSLEATKRADDLVRSAGGRFLDAPVSG 122 Query: 124 SKKPAEDGQLVILAAGDKDLYDQVVPAFDVLGKKSFFLGKIGNGAKMKLVVNMIMGSMMN 183 SK PAE G LV+LA G DL ++ P +GKK G++ G MKL++N+++G+MM Sbjct: 123 SKVPAEQGTLVVLAGGPSDLVQEMEPLLLTMGKKVVRCGEVPGGTAMKLMINLLLGTMMV 182 Query: 184 AFSEGIVLADKSGLDPHTLLDVLDLGAIANPMFKMKGPAMIKNSYPPAFPLKHQQKDMRL 243 F+E +V + GL+ +L+ + GA+A P+F +KG + + Y FP+ KD+ L Sbjct: 183 DFAEALVFGSRLGLETDAMLETIASGAMAAPLFALKGDTITRGDYTKHFPVDLVFKDLNL 242 Query: 244 ALALGDENAVPMPVAAAANEAFKKARSLGLGDLDFSAVFETLSK 287 LA P+P AA E + AR++G GD D +AV++ L + Sbjct: 243 VLAEAGSLGCPLPATAACREVYSAARAMGWGDEDMAAVYKVLQR 286 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 287 Length of database: 290 Length adjustment: 26 Effective length of query: 261 Effective length of database: 264 Effective search space: 68904 Effective search space used: 68904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory