Align Carbamate kinase; EC 2.7.2.2; Carbamate kinase-like carbamoylphosphate synthase (uncharacterized)
to candidate WP_073037756.1 BUB04_RS05565 carbamate kinase
Query= curated2:O59023 (314 letters) >NCBI__GCF_900129305.1:WP_073037756.1 Length = 314 Score = 263 bits (673), Expect = 3e-75 Identities = 139/310 (44%), Positives = 199/310 (64%), Gaps = 11/310 (3%) Query: 5 VVIALGGNALQQRGQKGTYDEMMENVRKTAKQIAEIIARGYEVVITHGNGPQVGTILLHM 64 +++ALGGNAL ++GQ+GT +E EN+R QIA + + ++ITHGNGPQVG +LL Sbjct: 11 LLVALGGNALIRKGQEGTIEEQFENLRVPMSQIARL-CESHRILITHGNGPQVGNLLLQQ 69 Query: 65 DAGQSLHGIPAQPMDVAGAMSQGWIGYMIQQALRNELRKRGI--EKEVVTIITQTIVDKK 122 + +P P+++ A +QG IGYMI+ L + L GI +K +V++I+ +VD K Sbjct: 70 ECCPH---VPRLPLEILVAQTQGQIGYMIESTLDSALMDLGIVTQKHLVSLISYVVVDPK 126 Query: 123 DPAFQNPTKPVGPFYDEKTAKKLAKEKGWVVKEDAGRGWRRVVPSPDPKGHVEAETIRRL 182 DPAF+NPTKP+GP Y E+ +L + VK+ A +G+RRVV SP P VE I+RL Sbjct: 127 DPAFRNPTKPIGPVYPEEVVPELP----FPVKKTA-KGYRRVVASPKPLHIVERREIQRL 181 Query: 183 VESGIIVIASGGGGVPVIEENGEIKGVEAVIDKDLAGEKLAEEVNADILMILTDVNGAAL 242 + +VI GGGG+PV+ E GV+AVIDKDLA +LA EV D+ I TDV GA + Sbjct: 182 IAMDFVVICCGGGGIPVVREGRSFAGVDAVIDKDLASARLAREVGVDLFCIATDVPGAYV 241 Query: 243 YYGTEKETWLRNVKVEELEKYYQEGHFKAGSMGPKVLAAIRFIKNGGKRAIIAHLEKAVE 302 +YG ++ L + EE E+ +EGHF GSMGPKV AA+ F++ GK A+I ++ Sbjct: 242 HYGRPEQRLLERLSAEEAERLAREGHFPQGSMGPKVEAAVEFVRATGKEAVITSIDAIEA 301 Query: 303 ALEGKTGTQV 312 A+EG+ GT++ Sbjct: 302 AVEGRAGTRI 311 Lambda K H 0.314 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 314 Length adjustment: 27 Effective length of query: 287 Effective length of database: 287 Effective search space: 82369 Effective search space used: 82369 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_073037756.1 BUB04_RS05565 (carbamate kinase)
to HMM TIGR00746 (arcC: carbamate kinase (EC 2.7.2.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00746.hmm # target sequence database: /tmp/gapView.9178.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00746 [M=309] Accession: TIGR00746 Description: arcC: carbamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-115 368.9 0.0 1e-114 368.7 0.0 1.0 1 lcl|NCBI__GCF_900129305.1:WP_073037756.1 BUB04_RS05565 carbamate kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900129305.1:WP_073037756.1 BUB04_RS05565 carbamate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 368.7 0.0 1e-114 1e-114 3 307 .. 11 311 .. 9 313 .. 0.97 Alignments for each domain: == domain 1 score: 368.7 bits; conditional E-value: 1e-114 TIGR00746 3 vvvaLGGnallqrgekasaeeqrknvekaakqlvklakrgyelvithGngPqvGalllqneaadsvpak 71 + vaLGGnal+++g+++++eeq +n++ +q+++l + +++++ithGngPqvG+lllq+e +vp lcl|NCBI__GCF_900129305.1:WP_073037756.1 11 LLVALGGNALIRKGQEGTIEEQFENLRVPMSQIARLCE-SHRILITHGNGPQVGNLLLQQECCPHVPRL 78 579***********************************.****************************** PP TIGR00746 72 PldvlgaesqgliGYllqqalkeelakegl..ekkvatvltqvivdekDeaFqnPtkpigpfydeeeak 138 Pl++l+a++qg+iGY+++ l+ +l + g+ +k+++ ++ v+vd+kD+aF+nPtkpigp+y ee lcl|NCBI__GCF_900129305.1:WP_073037756.1 79 PLEILVAQTQGQIGYMIESTLDSALMDLGIvtQKHLVSLISYVVVDPKDPAFRNPTKPIGPVYPEEVVP 147 **************************99863367899***************************99887 PP TIGR00746 139 rlaaekgailkedagrgwRrvvpsPkPkeiveaeviktLvekgvivissgGGGvPvvkdgkelkGveav 207 e + +k+ +++g+Rrvv+sPkP++ive + i+ L+ + +vi++gGGG+Pvv++g+++ Gv+av lcl|NCBI__GCF_900129305.1:WP_073037756.1 148 ----ELPFPVKK-TAKGYRRVVASPKPLHIVERREIQRLIAMDFVVICCGGGGIPVVREGRSFAGVDAV 211 ....88999999.99****************************************************** PP TIGR00746 208 iDkDlasekLaeevnaDilviltdvdavyvnygkpdekkleevkveeleelakdgefaaGsmgPkveaa 276 iDkDlas++La+ev+ D + i+tdv +yv+yg+p+++ le+++ ee+e+la++g+f +GsmgPkveaa lcl|NCBI__GCF_900129305.1:WP_073037756.1 212 IDKDLASARLAREVGVDLFCIATDVPGAYVHYGRPEQRLLERLSAEEAERLAREGHFPQGSMGPKVEAA 280 ********************************************************************* PP TIGR00746 277 iefvesrgkkaiitslekivealegkaGtvv 307 +efv+++gk+a+its++ i++a+eg aGt++ lcl|NCBI__GCF_900129305.1:WP_073037756.1 281 VEFVRATGKEAVITSIDAIEAAVEGRAGTRI 311 *****************************99 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (314 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.56 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory