Align 4-hydroxy-2-oxovalerate aldolase; HOA; EC 4.1.3.39; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxopentanoate aldolase (uncharacterized)
to candidate WP_073039178.1 BUB04_RS10320 2-isopropylmalate synthase
Query= curated2:A3P825 (347 letters) >NCBI__GCF_900129305.1:WP_073039178.1 Length = 504 Score = 65.5 bits (158), Expect = 3e-15 Identities = 80/276 (28%), Positives = 112/276 (40%), Gaps = 50/276 (18%) Query: 2 ILISDATLRDGNHAIRHQLSAAQIHAYARAADEAGIDVVEVGHG----NGLGGSSCLLGQ 57 I I D TLRDG +L+ Q A G+DV+E G L + Q Sbjct: 5 IHIFDTTLRDGEQVPGAKLNRRQKLEIAEQLARLGVDVIEAGFPCSSPEDLKAVQTVAEQ 64 Query: 58 T--PIGDRLMLETAR-------AALRTSRLGVHFIPGLGKAADISL----------ALEI 98 P+ L + A + R +H G ++DI L AL+ Sbjct: 65 VKGPVIAGLARAVQQDIDIAWEAVKKAERPRIHVFLG---SSDIHLQKKLRRDRESALQQ 121 Query: 99 GVDVVRVAT-HCTEANVSARFIEQTRTAGRTAFGVLMMSHMAPPDTLLAQAKLMERYGAQ 157 V+ V+ A +C + S T A R+ F + L + R GA Sbjct: 122 AVEAVKYAKKYCEDVEYS------TEDASRSDF-----------EYLCRVIEACIRAGAT 164 Query: 158 AVVLMDSAGYSTPSLVRAKVERL---VDGLD-IDVGFHAHNNLGLAVANSLVALEAGARI 213 + + D+ GY+ P + L V LD + + H HN+LGLAVANSL A+ GA Sbjct: 165 VINVPDTVGYALPEQYGELIRNLREKVPALDKVILSVHCHNDLGLAVANSLAAVRNGAEQ 224 Query: 214 VDACVKGFGAGAGNTQLETLVAAME-REG-HDTRTT 247 V+ + G G AGN LE +V A+ RE D TT Sbjct: 225 VECTINGVGERAGNASLEEIVMAIRTRESFFDAHTT 260 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 347 Length of database: 504 Length adjustment: 32 Effective length of query: 315 Effective length of database: 472 Effective search space: 148680 Effective search space used: 148680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory