Align ABC transporter for D-Alanine, permease component 2 (characterized)
to candidate WP_073039981.1 BUB04_RS12165 amino acid ABC transporter permease
Query= reanno::pseudo6_N2E2:Pf6N2E2_5403 (375 letters) >NCBI__GCF_900129305.1:WP_073039981.1 Length = 222 Score = 81.6 bits (200), Expect = 2e-20 Identities = 49/138 (35%), Positives = 80/138 (57%), Gaps = 3/138 (2%) Query: 238 VLIPELLALTLALTVYTAAFIAEIVRSGIKSVSHGQTEAARSLGLRNGPTLRKVIIPQAL 297 V +PE LAL++ + A++AEI+R+G+ SVS GQ EAA + GL +R V++PQAL Sbjct: 85 VRLPEYQTGILALSLNSGAYMAEIIRAGVLSVSWGQIEAAMAYGLNYFQRMRYVVLPQAL 144 Query: 298 RVIIPPLTSQYLNLAKNSSLAAGIGYPEMVSLFAGTVL-NQTGQAIEVIAITMSVYLAIS 356 + IPPL Q + L K+S+L + I E+ AG ++ ++ E T +YL I Sbjct: 145 GITIPPLLGQAIVLVKDSALLSLISVFELTR--AGQIITSERFMPAEGFFTTALLYLLIY 202 Query: 357 ISISLLMNWYNKRIALIE 374 ++ +W+ KR+ ++ Sbjct: 203 YALKAFSSWWQKRLIFVQ 220 Score = 45.4 bits (106), Expect = 1e-09 Identities = 26/68 (38%), Positives = 39/68 (57%) Query: 62 YARVFLIGLLNTLLVTFIGVILATILGFIIGVARLSQNWIISKLATVYVEVFRNIPPLLQ 121 Y +FL GL T ++ I + A ++G + ARLS+ I+S LA Y+E R+ P L Q Sbjct: 13 YMPLFLKGLWATAWLSAISLAGALLVGMVACGARLSKFRILSALAGAYIEAIRSTPLLAQ 72 Query: 122 ILFWYFAV 129 + F YF + Sbjct: 73 LYFLYFGL 80 Lambda K H 0.328 0.141 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 375 Length of database: 222 Length adjustment: 26 Effective length of query: 349 Effective length of database: 196 Effective search space: 68404 Effective search space used: 68404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory