Align High-affinity branched-chain amino acid ABC transporter permease LivM (characterized, see rationale)
to candidate WP_073040313.1 BUB04_RS13185 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A159ZYE0 (418 letters) >NCBI__GCF_900129305.1:WP_073040313.1 Length = 319 Score = 229 bits (583), Expect = 1e-64 Identities = 126/295 (42%), Positives = 177/295 (60%), Gaps = 23/295 (7%) Query: 115 DIATLILIYVMLGLGLNIVVGLAGLLDLGYVGFYAVGAYSYALLSHYFGLSFWICLPIAG 174 D+ I +Y LGL LN++VG AGL +LG+ FYAVGAY+ A+L+ F + LP+ Sbjct: 28 DVLNNIGLYAALGLSLNLIVGHAGLFNLGHAAFYAVGAYTAAILNTMFHIPVLALLPLCA 87 Query: 175 MMAATFGFLLGFPVLRLRGDYLAIVTLGFGEIIRLFL-RNLTDITGGPNGISNIEKPTFF 233 + A F L+ P++ LRGDYL IVT+G GEI+R+ L N+ ITGG NGI I +P F Sbjct: 88 LTAGIFALLVAKPIIHLRGDYLCIVTIGVGEIVRIALINNIFGITGGANGIFGISRPNLF 147 Query: 234 GLTFERKAAEGLQTFHEYFGLEYNSINKVIFLYLVALLLALAALFVINRLLRMPIGRAWE 293 GL + HE+F YL+ +A A F +RL GRA Sbjct: 148 GLVIRKP--------HEFF-------------YLIWFFVAATAFF-FHRLENSRFGRALN 185 Query: 294 ALREDEIACRALGLNPTVIKLSAFTLGAAFAGFAGSFFAARQGLVTPESFTFIESAIILA 353 LREDE A G++ KL AF +GAA+AG G+ +AA+ +++PESF+F ES ++ Sbjct: 186 YLREDETAAEGSGIDTAHYKLMAFVIGAAWAGMVGNLYAAKMTIISPESFSFWESVLMFT 245 Query: 354 IVVLGGMGSQLGVILAAIVMILLPEMMREFSEYRMLMFGALMVLMMIWRPQGLLP 408 +++LGG GS GV+L A ++I LPE+ R F+ RM++FGA M+ MMI+R G+LP Sbjct: 246 LIILGGSGSIPGVLLGAFLVIGLPEVFRGFTNARMMVFGAAMIAMMIFRTGGILP 300 Lambda K H 0.331 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 415 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 319 Length adjustment: 30 Effective length of query: 388 Effective length of database: 289 Effective search space: 112132 Effective search space used: 112132 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory