Align 3-hydroxybutyryl-CoA dehydrogenase; EC 1.1.1.157 (characterized)
to candidate WP_073041038.1 BUB04_RS15250 3-hydroxyacyl-CoA dehydrogenase family protein
Query= CharProtDB::CH_091789 (282 letters) >NCBI__GCF_900129305.1:WP_073041038.1 Length = 296 Score = 225 bits (573), Expect = 1e-63 Identities = 114/285 (40%), Positives = 186/285 (65%), Gaps = 4/285 (1%) Query: 1 MKKVCVIGAGTMGSGIAQAFAAKGFEVVLRDIKDEFVDRGLDFINKNLSKLVKKGKIEEA 60 +K++ V+GAG MGSGIAQ A G+ V L D+ DE ++R + I ++ KL +KG++ + Sbjct: 3 IKRIFVMGAGLMGSGIAQVAAQAGYSVSLCDVNDEALERAVKNIRWSVGKLAEKGRVSDP 62 Query: 61 TKVEILTRISGTVDLNMAADCDLVIEAAVERMDIKKQIFADLDNICKPETILASNTSSLS 120 + I+ RI T D+ AA DL IEA E ++IK+ +F LD +LA+NTS++ Sbjct: 63 VET-IVGRIEPTRDVGPAAGADLAIEAVFENLEIKRDVFQRLDQALPAHALLATNTSAIP 121 Query: 121 ITEVASAT--KRPDKVIGMHFFNPAPVMKLVEVIRGIATSQETFDAVKETSIAIGKDPVE 178 +T++A+A +R KV+G+HFF+P P+M+ VEV+R + T +ETF A ++ ++GK+P+ Sbjct: 122 VTQLAAAVSPERRPKVLGLHFFSPVPMMQAVEVVRAMTTGEETFLAGRDFVKSLGKEPIL 181 Query: 179 VA-EAPGFVVNRILIPMINEAVGILAEGIASVEDIDKAMKLGANHPMGPLELGDFIGLDI 237 V + PGF++NRI P EA+ ++ G+A+VED+DK ++L A MG E GD +GLD+ Sbjct: 182 VRKDVPGFLINRINFPATLEAMRLVEAGVATVEDVDKGLRLAAGRKMGIFETGDMVGLDV 241 Query: 238 CLAIMDVLYSETGDSKYRPHTLLKKYVRAGWLGRKSGKGFYDYSK 282 + ++ ET D ++ P +L++ V+ G LG+K+G+G+Y Y + Sbjct: 242 THGALLAIFEETKDPRWYPPAILRRKVQLGHLGKKTGRGWYVYDQ 286 Lambda K H 0.319 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 296 Length adjustment: 26 Effective length of query: 256 Effective length of database: 270 Effective search space: 69120 Effective search space used: 69120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory